Calpain S1 Antibody (3C4)


Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01] - Analysis of Calpain S1 expression in transfected 293T cell line by Calpain S1 monoclonal antibody (M01), clone 3C4.Lane 1: Calpain S1 transfected lysate(28.3 more
Immunocytochemistry/ Immunofluorescence: Calpain S1 Antibody (3C4) [H00000826-M01] - Analysis of monoclonal antibody to Calpain S1 on HeLa cell. Antibody concentration 20 ug/ml.
Immunohistochemistry-Paraffin: Calpain S1 Antibody (3C4) [H00000826-M01] - Analysis of monoclonal antibody to Calpain S1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Genetic Strategies: Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01] - Analysis of Calpain S1 over-expressed 293 cell line, cotransfected with Calpain S1 Validated Chimera RNAi ( Cat # H00000826-R01V ) more
Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01] - Calpain S1 monoclonal antibody (M01), clone 3C4. Analysis of Calpain S1 expression in PC-12.
Western Blot: Calpain S1 Antibody (3C4) [H00000826-M01] - Calpain S1 monoclonal antibody (M01), clone 3C4 Analysis of Calpain S1 expression in A-431.
Sandwich ELISA: Calpain S1 Antibody (3C4) [H00000826-M01] - Detection limit for recombinant GST tagged Calpain S1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, Func, ICC/IF, IHC, KD
Validated by:

Genetic Strategies


Order Details

Calpain S1 Antibody (3C4) Summary

Quality control test: Antibody Reactive Against Recombinant Protein.
Calpain S1 (AAH00592, 172 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Knockdown Validated
  • Proximity Ligation Assay
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.
Read Publications using H00000826-M01.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calpain S1 Antibody (3C4)

  • Calcium-activated neutral proteinase small subunit
  • Calcium-dependent protease small subunit 1
  • calcium-dependent protease, small subunit
  • calpain 4, small subunit (30K)
  • Calpain regulatory subunit
  • calpain small subunit 1
  • calpain, small polypeptide
  • CANP
  • CAPN4
  • CDPS
  • CSS1
  • epididymis secretory sperm binding protein


This gene is a member of the calpain small subunit family. Calpains are calcium-dependent cysteine proteinases that are widely distributed in mammalian cells. Calpains operate as heterodimers, comprising a specific large catalytic subunit (calpain 1 subunit in Calpain I, and calpain 2 subunit in Calpain II), and a common small regulatory subunit encoded by this gene. This encoded protein is essential for the stability and function of both calpain heterodimers, whose proteolytic activities influence various cellular functions including apoptosis, proliferation, migration, adhesion, and autophagy. Calpains have been implicated in neurodegenerative processes, such as myotonic dystrophy. A pseudogene of this gene has been defined on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calpain S1 Antibody (H00000826-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Calpain S1 Products

Research Areas for Calpain S1 Antibody (H00000826-M01)

Find related products by research area.

Blogs on Calpain S1

There are no specific blogs for Calpain S1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Calpain S1 Antibody (3C4) and receive a gift card or discount.


Gene Symbol CAPNS1