FAIM3 Antibody

Images

 
Western Blot: FAIM3 Antibody [NBP1-86924] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: FAIM3 Antibody [NBP1-86924] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & focal adhesion sites.
Immunohistochemistry-Paraffin: FAIM3 Antibody [NBP1-86924] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAIM3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAIM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAIM3 Recombinant Protein Antigen (NBP1-86924PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAIM3 Antibody

  • FAIM3
  • Fas apoptotic inhibitory molecule 3
  • Fc mu R
  • Fc mu receptor
  • FCMR
  • immunoglobulin mu Fc receptor
  • Regulator of Fas-induced apoptosis Toso
  • Toso
  • TOSOIgM Fc receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF144
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
MAB6302
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for FAIM3 Antibody (NBP1-86924) (0)

There are no publications for FAIM3 Antibody (NBP1-86924).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAIM3 Antibody (NBP1-86924) (0)

There are no reviews for FAIM3 Antibody (NBP1-86924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAIM3 Antibody (NBP1-86924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAIM3 Products

Bioinformatics Tool for FAIM3 Antibody (NBP1-86924)

Discover related pathways, diseases and genes to FAIM3 Antibody (NBP1-86924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAIM3 Antibody (NBP1-86924)

Discover more about diseases related to FAIM3 Antibody (NBP1-86924).
 

Pathways for FAIM3 Antibody (NBP1-86924)

View related products by pathway.

PTMs for FAIM3 Antibody (NBP1-86924)

Learn more about PTMs related to FAIM3 Antibody (NBP1-86924).
 

Research Areas for FAIM3 Antibody (NBP1-86924)

Find related products by research area.

Blogs on FAIM3

There are no specific blogs for FAIM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAIM3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAIM3
Entrez