FAIM1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAIM1 Antibody [NBP2-48764] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: FAIM1 Antibody [NBP2-48764] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAIM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKMTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGK
Specificity
Specificity of human FAIM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAIM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAIM1 Antibody

  • FAIM1FLJ10582
  • fas apoptotic inhibitory molecule 1
  • Fas apoptotic inhibitory molecule

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56141
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP1-82814
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF860
Species: Hu, Mu
Applications: WB, Simple Western, IP
H00010016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP

Publications for FAIM1 Antibody (NBP2-48764) (0)

There are no publications for FAIM1 Antibody (NBP2-48764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAIM1 Antibody (NBP2-48764) (0)

There are no reviews for FAIM1 Antibody (NBP2-48764). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAIM1 Antibody (NBP2-48764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAIM1 Products

Bioinformatics Tool for FAIM1 Antibody (NBP2-48764)

Discover related pathways, diseases and genes to FAIM1 Antibody (NBP2-48764). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAIM1 Antibody (NBP2-48764)

Discover more about diseases related to FAIM1 Antibody (NBP2-48764).
 

Pathways for FAIM1 Antibody (NBP2-48764)

View related products by pathway.

PTMs for FAIM1 Antibody (NBP2-48764)

Learn more about PTMs related to FAIM1 Antibody (NBP2-48764).
 

Research Areas for FAIM1 Antibody (NBP2-48764)

Find related products by research area.

Blogs on FAIM1

There are no specific blogs for FAIM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAIM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAIM