FADS3 Antibody

Immunocytochemistry/Immunofluorescence: FADS3 Antibody [NBP1-91877] - Staining of human cell line RH-30 shows localization to nucleoli fibrillar center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FADS3 Antibody [NBP1-91877] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FADS3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FADS3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FADS3 Protein (NBP1-91877PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FADS3 Antibody

• CYB5RPlinoleoyl-CoA desaturase (delta-9-desaturase)-like 3
• Cytochrome b5-related protein
• delta-9 fatty acid desaturase
• delta-9-desaturase
• EC 1.14.19
• EC 1.14.19.-
• fatty acid desaturase 3
• LLCDL3

Background

The FADS3 gene encodes a 445 amino acid long, 51 kDA fatty acid desaturase 3 protein that, through the introduction of double bonds between carbons of the fatty acids, regulate unsaturation of fatty acids. FADS3 is associated with familial combined hyperlipidemia and coronary heart disease. FADS3 interacts with the UBC gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FADS3