FADD Antibody

Images

 
Orthogonal Strategies: Western Blot: FADD Antibody [NBP1-81831] - Analysis in human cell lines A-431 and HeLa using Anti-FADD antibody. Corresponding FADD RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: FADD Antibody [NBP1-81831] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: FADD Antibody [NBP1-81831] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.
Western Blot: FADD Antibody [NBP1-81831] - Analysis in human cell line Jurkat.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FADD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN
Specificity
Specificity of human FADD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FADD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
FADD Lysate (NBP2-65359)
Control Peptide
FADD Protein (NBP1-81831PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FADD Antibody

  • FADD
  • Fas (TNFRSF6)-associated via death domain
  • FAS-associated death domain protein
  • FAS-associating death domain-containing protein
  • GIG3
  • Growth-inhibiting gene 3 protein
  • Mediator of receptor induced toxicity
  • mediator of receptor-induced toxicity
  • MGC8528
  • MORT1
  • MORT1Fas-associating protein with death domain
  • protein FADD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56141
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF860
Species: Hu, Mu
Applications: WB, Simple Western, IP

Publications for FADD Antibody (NBP1-81831) (0)

There are no publications for FADD Antibody (NBP1-81831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FADD Antibody (NBP1-81831) (0)

There are no reviews for FADD Antibody (NBP1-81831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FADD Antibody (NBP1-81831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FADD Antibody (NBP1-81831)

Discover related pathways, diseases and genes to FADD Antibody (NBP1-81831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FADD Antibody (NBP1-81831)

Discover more about diseases related to FADD Antibody (NBP1-81831).
 

Pathways for FADD Antibody (NBP1-81831)

View related products by pathway.

PTMs for FADD Antibody (NBP1-81831)

Learn more about PTMs related to FADD Antibody (NBP1-81831).

Blogs on FADD.

Apoptosis and Necroptosis Part II: Inhibitors of apoptosis proteins (IAPs); Key regulators of the balance between necroptosis, apoptosis and survival
In the first installment of this two-part blog post titled "Apoptosis and Necroptosis: Important factors to identify both types of programmed cell death", the mechanisms by which cell death occurs and ways to identify these pathways were...  Read full blog post.

FADD - important initiator of death receptor-mediated apoptosis
FAS-associated death domain protein (FADD) is a 23 kDa adaptor protein involved in initiating apoptosis. FADD is best known for its involvement in extrinsic/death receptor-mediated apoptosis, but it is also involved in initiating necroptosis with ...  Read full blog post.

Caspase 9: The Suicidal Cell Whisperer
Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands which signal through downstream adaptor molecules and the caspase protease family. Among the subclass of initiator caspases that include...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FADD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FADD
Entrez