Factor XIIIb Antibody - BSA Free

Western Blot: Factor XIIIb Antibody [NBP1-89811] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: Factor XIIIb Antibody [NBP1-89811] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: Factor XIIIb Antibody [NBP1-89811] - Staining of human duodenum shows positivity in plasma in blood vessels.

Immunohistochemistry-Paraffin: Factor XIIIb Antibody [NBP1-89811] - Staining of human kidney shows cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Factor XIIIb Antibody [NBP1-89811] - Staining of human placenta shows positivity in plasma.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Factor XIIIb Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Factor XIIIb Protein corresponding to amino acids: FCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: F13B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Factor XIII Protein (NBP1-89811PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Factor XIIIb Antibody - BSA Free

• coagulation factor XIII B chain
• coagulation factor XIII, B polypeptide
• F13B
• fibrin-stabilizing factor B subunit
• FXIIIB
• protein-glutamine gamma-glutamyltransferase B chain
• TGase
• transglutaminase B chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Factor XIIIb Antibody (NBP1-89811)(2)

Publications using NBP1-89811

• Zhou C, Simpson KL, Lancashire LJ et al. Statistical considerations of optimal study design for human plasma proteomics and biomarker discovery. J Proteome Res 2012-04-01 [PMID: 22338609]
• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]

FAQs for Factor XIIIb Antibody (NBP1-89811). (Showing 1 - 1 of 1 FAQs).

1. Regarding NBP1-89811 FXIII ab. Could you please tell me if this antibody recognizes the FXIII a subunits? Or both A and B? It cannot be seen from the datasheet, and I do not know the A subunit's sequence. Could you recommend an antibody directed to FXIII A?
   • This antibody detects FXIII B subunit. We do have several antibodies that detect the A subunit. As I do not know your planned application, I can not recommend one specifically, but you should be able to find one that suits your need.

Bioinformatics

• Gene Symbol: F13B