Factor V Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Factor V Antibody [NBP1-88114] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & the Golgi apparatus.
Immunohistochemistry-Paraffin: Factor V Antibody [NBP1-88114] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Factor V Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
F5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Factor V Protein (NBP1-88114PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Factor V Antibody

  • Activated protein C cofactor
  • coagulation factor V (proaccelerin, labile factor)
  • coagulation factor V jinjiang A2 domain
  • coagulation factor V
  • factor V Leiden
  • FVL
  • PCCF
  • Proaccelerin, labile factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1267
Species: Hu
Applications: WB, IP, Neut
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF2338
Species: Hu
Applications: WB, IP, ICC
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Factor V Antibody (NBP1-88114) (0)

There are no publications for Factor V Antibody (NBP1-88114).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor V Antibody (NBP1-88114) (0)

There are no reviews for Factor V Antibody (NBP1-88114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Factor V Antibody (NBP1-88114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Factor V Products

Bioinformatics Tool for Factor V Antibody (NBP1-88114)

Discover related pathways, diseases and genes to Factor V Antibody (NBP1-88114). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor V Antibody (NBP1-88114)

Discover more about diseases related to Factor V Antibody (NBP1-88114).
 

Pathways for Factor V Antibody (NBP1-88114)

View related products by pathway.

PTMs for Factor V Antibody (NBP1-88114)

Learn more about PTMs related to Factor V Antibody (NBP1-88114).

Blogs on Factor V.

Factor VIII - a key factor in the clotting process
Hemostasis, or blood clotting, follows tissue injury and involves the deployment of essential plasma procoagulants (such as prothrombin, and Factors X, IX, V, and VIII) that trigger the blood coagulation cascade. This cascade leads to the formation...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Factor V Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol F5
Entrez
Uniprot