FACL4 Antibody

Images

 
Western Blot: FACL4 Antibody [NBP1-69303] - This Anti-ACSL4 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FACL4 Antibody Summary

Immunogen
Synthetic peptides corresponding to ACSL4(acyl-CoA synthetase long-chain family member 4) The peptide sequence was selected from the N terminal of ACSL4. Peptide sequence AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACSL4 and was validated on Western blot.
Theoretical MW
74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FACL4 Antibody

  • ACS4mental retardation, X-linked 68
  • acyl-CoA synthetase 4
  • acyl-CoA synthetase long-chain family member 4
  • EC 6.2.1.3
  • FACL4long-chain 4
  • LACS 4
  • LACS4MRX68
  • lignoceroyl-CoA synthase
  • Long-chain acyl-CoA synthetase 4
  • long-chain fatty-acid-Coenzyme A ligase 4
  • long-chain-fatty-acid--CoA ligase 4
  • mental retardation, X-linked 63
  • MRX63

Background

ACSL4 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
H00002181-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92088
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-71565
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FACL4 Antibody (NBP1-69303) (0)

There are no publications for FACL4 Antibody (NBP1-69303).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FACL4 Antibody (NBP1-69303) (0)

There are no reviews for FACL4 Antibody (NBP1-69303). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FACL4 Antibody (NBP1-69303) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FACL4 Products

Bioinformatics Tool for FACL4 Antibody (NBP1-69303)

Discover related pathways, diseases and genes to FACL4 Antibody (NBP1-69303). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FACL4 Antibody (NBP1-69303)

Discover more about diseases related to FACL4 Antibody (NBP1-69303).
 

Pathways for FACL4 Antibody (NBP1-69303)

View related products by pathway.

PTMs for FACL4 Antibody (NBP1-69303)

Learn more about PTMs related to FACL4 Antibody (NBP1-69303).
 

Research Areas for FACL4 Antibody (NBP1-69303)

Find related products by research area.

Blogs on FACL4

There are no specific blogs for FACL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FACL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL4
Uniprot