FACA/FANCA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FACA/FANCA Antibody [NBP2-56898] - Staining of human cell line MCF7 shows localization to nucleus. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FACA/FANCA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LQALTSGWSVAASLQRQRELLMYKRILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFF
Specificity
Specificity of human FACA/FANCA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FANCA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FACA/FANCA Recombinant Protein Antigen (NBP2-56898PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FACA/FANCA Antibody

  • FA
  • FA1
  • FAA
  • FAAMGC75158
  • FACA
  • FACAFanconi anemia group A protein
  • FAH
  • FA-H
  • FANCA
  • FANCH
  • Fanconi anemia, complementation group A
  • Fanconi anemia, complementation group H
  • Fanconi anemia, type 1
  • Protein FACA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-38958
Species: Hu
Applications: IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
H00002189-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NBP2-56898
Species: Hu
Applications: ICC/IF

Publications for FACA/FANCA Antibody (NBP2-56898) (0)

There are no publications for FACA/FANCA Antibody (NBP2-56898).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FACA/FANCA Antibody (NBP2-56898) (0)

There are no reviews for FACA/FANCA Antibody (NBP2-56898). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FACA/FANCA Antibody (NBP2-56898) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FACA/FANCA Products

Bioinformatics Tool for FACA/FANCA Antibody (NBP2-56898)

Discover related pathways, diseases and genes to FACA/FANCA Antibody (NBP2-56898). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FACA/FANCA Antibody (NBP2-56898)

Discover more about diseases related to FACA/FANCA Antibody (NBP2-56898).
 

Pathways for FACA/FANCA Antibody (NBP2-56898)

View related products by pathway.

PTMs for FACA/FANCA Antibody (NBP2-56898)

Learn more about PTMs related to FACA/FANCA Antibody (NBP2-56898).
 

Research Areas for FACA/FANCA Antibody (NBP2-56898)

Find related products by research area.

Blogs on FACA/FANCA

There are no specific blogs for FACA/FANCA, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FACA/FANCA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCA