FA2H Antibody


Immunohistochemistry-Paraffin: FA2H Antibody [NBP2-37957] - Staining of human vagina shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

FA2H Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGS
Specificity of human FA2H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FA2H Protein (NBP2-37957PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FA2H Antibody

  • FAH1
  • fatty acid 2-hydroxylase
  • Fatty acid alpha-hydroxylase
  • fatty acid hydroxylase domain containing 1
  • FLJ25287
  • SCS7
  • spastic paraplegia 35 (autosomal recessive)
  • SPG35


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
Species: Hu, Ca
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, Flow-CS
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for FA2H Antibody (NBP2-37957) (0)

There are no publications for FA2H Antibody (NBP2-37957).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FA2H Antibody (NBP2-37957) (0)

There are no reviews for FA2H Antibody (NBP2-37957). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FA2H Antibody (NBP2-37957) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FA2H Products

Bioinformatics Tool for FA2H Antibody (NBP2-37957)

Discover related pathways, diseases and genes to FA2H Antibody (NBP2-37957). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FA2H Antibody (NBP2-37957)

Discover more about diseases related to FA2H Antibody (NBP2-37957).

Pathways for FA2H Antibody (NBP2-37957)

View related products by pathway.

PTMs for FA2H Antibody (NBP2-37957)

Learn more about PTMs related to FA2H Antibody (NBP2-37957).

Research Areas for FA2H Antibody (NBP2-37957)

Find related products by research area.

Blogs on FA2H

There are no specific blogs for FA2H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FA2H Antibody and receive a gift card or discount.


Gene Symbol FA2H