FA2H Antibody

Images

 
Immunohistochemistry-Paraffin: FA2H Antibody [NBP2-37957] - Staining of human vagina shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FA2H Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FA2H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
FA2H Protein (NBP2-37957PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FA2H Antibody

  • FAAHFAXDC1
  • FAH1
  • fatty acid 2-hydroxylase
  • Fatty acid alpha-hydroxylase
  • fatty acid hydroxylase domain containing 1
  • FLJ25287
  • SCS7
  • spastic paraplegia 35 (autosomal recessive)
  • SPG35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF4886
Species: Mu
Applications: WB, IP
NB100-2307
Species: Hu
Applications: WB
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-57234
Species: Hu
Applications: ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37957
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for FA2H Antibody (NBP2-37957) (0)

There are no publications for FA2H Antibody (NBP2-37957).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FA2H Antibody (NBP2-37957) (0)

There are no reviews for FA2H Antibody (NBP2-37957). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FA2H Antibody (NBP2-37957) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FA2H Products

Bioinformatics Tool for FA2H Antibody (NBP2-37957)

Discover related pathways, diseases and genes to FA2H Antibody (NBP2-37957). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FA2H Antibody (NBP2-37957)

Discover more about diseases related to FA2H Antibody (NBP2-37957).
 

Pathways for FA2H Antibody (NBP2-37957)

View related products by pathway.

PTMs for FA2H Antibody (NBP2-37957)

Learn more about PTMs related to FA2H Antibody (NBP2-37957).
 

Research Areas for FA2H Antibody (NBP2-37957)

Find related products by research area.

Blogs on FA2H

There are no specific blogs for FA2H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FA2H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FA2H
Uniprot