FA2H Antibody


Western Blot: FA2H Antibody [NBP1-68928] - Mouse Liver lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

FA2H Antibody Summary

Synthetic peptides corresponding to Fa2h (fatty acid 2-hydroxylase) The peptide sequence was selected from the C terminal of Fa2h. Peptide sequence HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Fa2h and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FA2H Antibody

  • FAH1
  • fatty acid 2-hydroxylase
  • Fatty acid alpha-hydroxylase
  • fatty acid hydroxylase domain containing 1
  • FLJ25287
  • SCS7
  • spastic paraplegia 35 (autosomal recessive)
  • SPG35


Fa2h is required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
Species: Hu, Ca
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, Flow-CS
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB

Publications for FA2H Antibody (NBP1-68928) (0)

There are no publications for FA2H Antibody (NBP1-68928).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FA2H Antibody (NBP1-68928) (0)

There are no reviews for FA2H Antibody (NBP1-68928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FA2H Antibody (NBP1-68928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FA2H Products

Bioinformatics Tool for FA2H Antibody (NBP1-68928)

Discover related pathways, diseases and genes to FA2H Antibody (NBP1-68928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FA2H Antibody (NBP1-68928)

Discover more about diseases related to FA2H Antibody (NBP1-68928).

Pathways for FA2H Antibody (NBP1-68928)

View related products by pathway.

PTMs for FA2H Antibody (NBP1-68928)

Learn more about PTMs related to FA2H Antibody (NBP1-68928).

Blogs on FA2H

There are no specific blogs for FA2H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FA2H Antibody and receive a gift card or discount.


Gene Symbol FA2H