EYA1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human EYA1. Peptide sequence: QDLTSPHSRLSGSSESPSGPKLGNSHINSNSMTPNGTEVKTEPMSSSETA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EYA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for EYA1 Antibody - BSA Free
Background
The EYA1 gene encodes an eyes absent homolog 1 protein that exists in three isoforms: isoform 1: 592 amino acids long, 64 kDA; isoform 2: 559 amino acids long, 61 kDA; and isoform 3: 557 amino acids long; 60 kDA. The protein coded by the EYA1 gene functions in the development of the kidney, brancial arches, eyes, and ears. Mutations in the EYA1 gene lead to branchiootorenal dysplasia syndrome, congenital cataracts and ocular anterior segment anomalies, and branchiootic syndrome. The EYA1 gene is also linked to fraser syndrome, microphthalmia, cataracts, enlarged vestibular aqueducts, townes-brocks syndrome, and anophthalmia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB
Publications for EYA1 Antibody (NBP2-87381) (0)
There are no publications for EYA1 Antibody (NBP2-87381).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EYA1 Antibody (NBP2-87381) (0)
There are no reviews for EYA1 Antibody (NBP2-87381).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EYA1 Antibody (NBP2-87381) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EYA1 Products
Research Areas for EYA1 Antibody (NBP2-87381)
Find related products by research area.
|
Blogs on EYA1