Recombinant Human EWSR1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human EWSR1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 358-453 of Human EWSR1

Source: Wheat Germ

Amino Acid Sequence: SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
EWSR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EWSR1 Protein

  • bK984G1.4
  • Ewing sarcoma breakpoint region 1 protein
  • Ewing sarcoma breakpoint region 1
  • Ewings sarcoma EWS-Fli1 (type 1) oncogene
  • EWS oncogene
  • EWSRNA-binding protein EWS

Background

EWSR1 - Ewing sarcoma breakpoint region 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67019
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00003757-Q01
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38747
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-92685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
PP-H7833-00
Species: Hu
Applications: WB, IP
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-65358
Species: Hu
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
H00002130-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for EWSR1 Partial Recombinant Protein (H00002130-Q01) (0)

There are no publications for EWSR1 Partial Recombinant Protein (H00002130-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EWSR1 Partial Recombinant Protein (H00002130-Q01) (0)

There are no reviews for EWSR1 Partial Recombinant Protein (H00002130-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EWSR1 Partial Recombinant Protein (H00002130-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EWSR1 Products

Bioinformatics Tool for EWSR1 Partial Recombinant Protein (H00002130-Q01)

Discover related pathways, diseases and genes to EWSR1 Partial Recombinant Protein (H00002130-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EWSR1 Partial Recombinant Protein (H00002130-Q01)

Discover more about diseases related to EWSR1 Partial Recombinant Protein (H00002130-Q01).
 

Pathways for EWSR1 Partial Recombinant Protein (H00002130-Q01)

View related products by pathway.

PTMs for EWSR1 Partial Recombinant Protein (H00002130-Q01)

Learn more about PTMs related to EWSR1 Partial Recombinant Protein (H00002130-Q01).
 

Research Areas for EWSR1 Partial Recombinant Protein (H00002130-Q01)

Find related products by research area.

Blogs on EWSR1

There are no specific blogs for EWSR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EWSR1 Antibody
NBP2-49020

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EWSR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EWSR1