Recombinant Human EWSR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EWSR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-96 of Human EWSR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS

Protein/Peptide Type
Partial Recombinant Protein
Gene
EWSR1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EWSR1 Protein

  • bK984G1.4
  • Ewing sarcoma breakpoint region 1 protein
  • Ewing sarcoma breakpoint region 1
  • Ewings sarcoma EWS-Fli1 (type 1) oncogene
  • EWS oncogene
  • EWSRNA-binding protein EWS

Background

EWSR1 - Ewing sarcoma breakpoint region 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3968
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBL1-12154
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80703
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
H00002130-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for EWSR1 Partial Recombinant Protein (H00002130-Q01) (0)

There are no publications for EWSR1 Partial Recombinant Protein (H00002130-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EWSR1 Partial Recombinant Protein (H00002130-Q01) (0)

There are no reviews for EWSR1 Partial Recombinant Protein (H00002130-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EWSR1 Partial Recombinant Protein (H00002130-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EWSR1 Products

Bioinformatics Tool for EWSR1 Partial Recombinant Protein (H00002130-Q01)

Discover related pathways, diseases and genes to EWSR1 Partial Recombinant Protein (H00002130-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EWSR1 Partial Recombinant Protein (H00002130-Q01)

Discover more about diseases related to EWSR1 Partial Recombinant Protein (H00002130-Q01).
 

Pathways for EWSR1 Partial Recombinant Protein (H00002130-Q01)

View related products by pathway.

PTMs for EWSR1 Partial Recombinant Protein (H00002130-Q01)

Learn more about PTMs related to EWSR1 Partial Recombinant Protein (H00002130-Q01).
 

Research Areas for EWSR1 Partial Recombinant Protein (H00002130-Q01)

Find related products by research area.

Blogs on EWSR1

There are no specific blogs for EWSR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GDNF [Unconjugated]
212-GD-010/CF
EWSR1 Antibody
NB200-182

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EWSR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EWSR1