EWSR1 Antibody (3A9)

Images

 
Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody (3A9) [H00002130-M02] - Analysis of monoclonal antibody to EWSR1 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: EWSR1 Antibody (3A9) [H00002130-M02] - Detection limit for recombinant GST tagged EWSR1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EWSR1 Antibody (3A9) Summary

Immunogen
EWSR1 (NP_005234 358 a.a. - 453 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EWSR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EWSR1 Antibody (3A9)

  • bK984G1.4
  • Ewing sarcoma breakpoint region 1 protein
  • Ewing sarcoma breakpoint region 1
  • Ewings sarcoma EWS-Fli1 (type 1) oncogene
  • EWS oncogene
  • EWSRNA-binding protein EWS

Background

This gene encodes a putative RNA binding protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in two products.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3968
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBL1-12154
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80703
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
H00002130-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for EWSR1 Antibody (H00002130-M02) (0)

There are no publications for EWSR1 Antibody (H00002130-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EWSR1 Antibody (H00002130-M02) (0)

There are no reviews for EWSR1 Antibody (H00002130-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EWSR1 Antibody (H00002130-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EWSR1 Products

Bioinformatics Tool for EWSR1 Antibody (H00002130-M02)

Discover related pathways, diseases and genes to EWSR1 Antibody (H00002130-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EWSR1 Antibody (H00002130-M02)

Discover more about diseases related to EWSR1 Antibody (H00002130-M02).
 

Pathways for EWSR1 Antibody (H00002130-M02)

View related products by pathway.

PTMs for EWSR1 Antibody (H00002130-M02)

Learn more about PTMs related to EWSR1 Antibody (H00002130-M02).
 

Research Areas for EWSR1 Antibody (H00002130-M02)

Find related products by research area.

Blogs on EWSR1

There are no specific blogs for EWSR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EWSR1 Antibody (3A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol EWSR1
Uniprot