EVI2A Antibody

Images

 
Immunohistochemistry: EVI2A Antibody [NBP2-30525] - Staining of human nasopharynx shows strong positivity in cilia of respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EVI2A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EVI2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EVI2A Protein (NBP2-30525PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EVI2A Antibody

  • ecotropic viral integration site 2A
  • EVDAEVI2Ecotropic viral integration site 2A protein homolog
  • EVI-2A
  • protein EVI2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85342
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1674
Species: Mu
Applications: WB
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
NB100-1319
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-30884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for EVI2A Antibody (NBP2-30525) (0)

There are no publications for EVI2A Antibody (NBP2-30525).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EVI2A Antibody (NBP2-30525) (0)

There are no reviews for EVI2A Antibody (NBP2-30525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EVI2A Antibody (NBP2-30525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EVI2A Products

Bioinformatics Tool for EVI2A Antibody (NBP2-30525)

Discover related pathways, diseases and genes to EVI2A Antibody (NBP2-30525). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EVI2A Antibody (NBP2-30525)

Discover more about diseases related to EVI2A Antibody (NBP2-30525).
 

Pathways for EVI2A Antibody (NBP2-30525)

View related products by pathway.

PTMs for EVI2A Antibody (NBP2-30525)

Learn more about PTMs related to EVI2A Antibody (NBP2-30525).

Blogs on EVI2A

There are no specific blogs for EVI2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EVI2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EVI2A
Uniprot