UTP6 Antibody

Images

 
Western Blot: UTP6 Antibody [NBP1-88468] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: UTP6 Antibody [NBP1-88468] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human hippocampus shows strong nucleolar positivity in neuronal cells.
Western Blot: UTP6 Antibody [NBP1-88468] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UTP6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UTP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UTP6 Protein (NBP1-88468PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UTP6 Antibody

  • C17orf40
  • chromosome 17 open reading frame 40
  • HCA66hepatocellular carcinoma associated antigen 66
  • Hepatocellular carcinoma-associated antigen 66
  • MHAT
  • Multiple hat domains protein
  • U3 small nucleolar RNA-associated protein 6 homolog
  • UTP6, small subunit (SSU) processome component, homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1319
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-30884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-53097
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-85342
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30525
Species: Hu
Applications: IHC, IHC-P
NBP1-92547
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13511
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00121441-M05
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-38364
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1674
Species: Mu
Applications: WB
NBP2-30966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45496
Species: Hu
Applications: WB, IHC
NBP1-88468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UTP6 Antibody (NBP1-88468) (0)

There are no publications for UTP6 Antibody (NBP1-88468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UTP6 Antibody (NBP1-88468) (0)

There are no reviews for UTP6 Antibody (NBP1-88468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UTP6 Antibody (NBP1-88468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UTP6 Products

Bioinformatics Tool for UTP6 Antibody (NBP1-88468)

Discover related pathways, diseases and genes to UTP6 Antibody (NBP1-88468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UTP6 Antibody (NBP1-88468)

Discover more about diseases related to UTP6 Antibody (NBP1-88468).
 

Pathways for UTP6 Antibody (NBP1-88468)

View related products by pathway.

Blogs on UTP6

There are no specific blogs for UTP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UTP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UTP6