COPR5 Antibody


Immunohistochemistry-Paraffin: COPR5 Antibody [NBP2-30884] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: COPR5 Antibody [NBP2-30884] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: COPR5 Antibody [NBP2-30884] - Staining of human colon shows strong nuclear and moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: COPR5 Antibody [NBP2-30884] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

COPR5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. COPR5 antibody validated for WB from a verified customer review.
Control Peptide
COPR5 Protein (NBP2-30884PEP)
Reviewed Applications
Read 1 Review rated 4
NBP2-30884 in the following applications:

Read Publications using
NBP2-30884 in the following applications:

  • WB
    2 publications

Reactivity Notes

Human, Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for COPR5 Antibody

  • C17orf79
  • chromosome 17 open reading frame 79
  • cooperator of PRMT5
  • COPR5
  • FLJ21119
  • HSA272196
  • Protein TTP1
  • TTP1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for COPR5 Antibody (NBP2-30884)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Review for COPR5 Antibody (NBP2-30884) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human and Mouse.

Reviews using NBP2-30884:
Filter by Applications
All Applications
Filter by Species
Human and Mouse
All Species
Images Ratings Applications Species Date Details
Western Blot COPR5 NBP2-30884
reviewed by:
Verified Customer
WB Human and Mouse 10/17/2019


ApplicationWestern Blot
Sample Tested Hela whole cell lysate, Mouse brain,HEK 293 cell line,Human glioma U87 Cell
SpeciesHuman and Mouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COPR5 Antibody (NBP2-30884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional COPR5 Products

Bioinformatics Tool for COPR5 Antibody (NBP2-30884)

Discover related pathways, diseases and genes to COPR5 Antibody (NBP2-30884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COPR5 Antibody (NBP2-30884)

Discover more about diseases related to COPR5 Antibody (NBP2-30884).

Pathways for COPR5 Antibody (NBP2-30884)

View related products by pathway.

Blogs on COPR5

There are no specific blogs for COPR5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Verified Customer
Application: WB
Species: Human and Mouse


Gene Symbol COPRS