COPR5 Antibody

Images

 
Western Blot: COPR5 Antibody [NBP2-30884] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: COPR5 Antibody [NBP2-30884] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: COPR5 Antibody [NBP2-30884] - Staining of human epididymis shows nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COPR5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COPRS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COPR5 Protein (NBP2-30884PEP)
Publications
Read Publication using
NBP2-30884 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COPR5 Antibody

  • C17orf79
  • chromosome 17 open reading frame 79
  • cooperator of PRMT5
  • COPR5
  • FLJ21119
  • HSA272196
  • Protein TTP1
  • TTP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56641
Species: Hu, Mu
Applications: WB
NBP2-46258
Species: Hu
Applications: WB, IHC
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6810
Species: Hu
Applications: WB, Simple Western, IHC
NB100-1319
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-89705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01291
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11569
Species: Hu
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
AF1674
Species: Mu
Applications: WB
NBP2-30884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COPR5 Antibody (NBP2-30884)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for COPR5 Antibody (NBP2-30884) (0)

There are no reviews for COPR5 Antibody (NBP2-30884). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COPR5 Antibody (NBP2-30884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COPR5 Products

Bioinformatics Tool for COPR5 Antibody (NBP2-30884)

Discover related pathways, diseases and genes to COPR5 Antibody (NBP2-30884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COPR5 Antibody (NBP2-30884)

Discover more about diseases related to COPR5 Antibody (NBP2-30884).
 

Pathways for COPR5 Antibody (NBP2-30884)

View related products by pathway.

Blogs on COPR5

There are no specific blogs for COPR5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COPR5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COPRS
Uniprot