COPR5 Antibody

Images

 
Immunohistochemistry-Paraffin: COPR5 Antibody [NBP2-30884] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: COPR5 Antibody [NBP2-30884] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: COPR5 Antibody [NBP2-30884] - Staining of human colon shows strong nuclear and moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: COPR5 Antibody [NBP2-30884] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COPR5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE
Specificity
Specificity of human COPR5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COPRS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. COPR5 antibody validated for WB from a verified customer review.
Control Peptide
COPR5 Protein (NBP2-30884PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-30884 in the following applications:

Publications
Read Publication using
NBP2-30884 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human, Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COPR5 Antibody

  • C17orf79
  • chromosome 17 open reading frame 79
  • cooperator of PRMT5
  • COPR5
  • FLJ21119
  • HSA272196
  • Protein TTP1
  • TTP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67075
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46258
Species: Hu
Applications: WB, IHC
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6810
Species: Hu
Applications: WB, Simple Western, IHC
NB100-1319
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-89705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-05061
Species: Hu, Mu
Applications: WB, ICC/IF
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-01291
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-82483
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30884
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for COPR5 Antibody (NBP2-30884)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for COPR5 Antibody (NBP2-30884) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human and Mouse.

Reviews using NBP2-30884:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot COPR5 NBP2-30884
Enlarge
4
reviewed by:
Anonymous
WB Human and Mouse 10/17/2019
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 cell line, Hela whole cell lysate,Human glioma U87 Cell, Mouse brain
SpeciesHuman and Mouse
LotA118309

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COPR5 Antibody (NBP2-30884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional COPR5 Products

Bioinformatics Tool for COPR5 Antibody (NBP2-30884)

Discover related pathways, diseases and genes to COPR5 Antibody (NBP2-30884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COPR5 Antibody (NBP2-30884)

Discover more about diseases related to COPR5 Antibody (NBP2-30884).
 

Pathways for COPR5 Antibody (NBP2-30884)

View related products by pathway.

Blogs on COPR5

There are no specific blogs for COPR5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
10/17/2019
Application: WB
Species: Human and Mouse

Bioinformatics

Gene Symbol COPRS
Uniprot