Reactivity | Hu, MuSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE |
Specificity | Specificity of human COPR5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | COPRS |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. COPR5 antibody validated for WB from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-30884 | Applications | Species |
---|---|---|
Strahan RC, McDowell-Sargent M, Uppal T et al. KSHV encoded ORF59 modulates histone arginine methylation of the viral genome to promote viral reactivation PLoS Pathog. 2017 Jul 01 [PMID: 28678843] (WB, Human) | WB | Human |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
WB | Human and Mouse | 10/17/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for COPR5 Antibody (NBP2-30884)Discover more about diseases related to COPR5 Antibody (NBP2-30884).
| Pathways for COPR5 Antibody (NBP2-30884)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.