PIG3 Antibody - BSA Free

Western Blot: PIG3 Antibody [NBP1-87275] - Analysis using Anti-TP53I3 antibody NBP1-87275 (A) shows similar pattern to independent antibody NBP1-87274 (B).

Immunocytochemistry/Immunofluorescence: PIG3 Antibody [NBP1-87275] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87275] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87275] - Staining of human heart muscle shows no positivity in cardiomyocytes as expected.

Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87275] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87275] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87275] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87275] - Analysis in human duodenum and heart muscle tissues. Corresponding TP53I3 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIG3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TP53I3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PIG3 Protein (NBP1-87275PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PIG3 Antibody - BSA Free

• p53-induced gene 3 protein
• PIG3quinone oxidoreductase homolog
• quinone oxidoreductase PIG3
• tumor protein p53 inducible protein 3
• Tumor protein p53-inducible protein 3

Background

May be involved in the generation of reactive oxygen species (ROS). Has low NADPH-dependent naphtoquinone reductase activity, with a preference for 1,2-naphtoquinone over 1,4-naphtoquinone. Has low NADPH-dependent diamine reductase activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TP53I3