ETHE1 Antibody

Images

 
Western Blot: ETHE1 Antibody [NBP1-81688] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ETHE1 Antibody [NBP1-81688] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: ETHE1 Antibody [NBP1-81688] - Staining of human rectum shows strong cytoplasmic positivity(granular pattern) in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

ETHE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETHE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
ETHE1 Protein (NBP1-81688PEP)

Alternate Names for ETHE1 Antibody

  • D83198
  • EC 3.1.2.6
  • ethylmalonic encephalopathy 1
  • Ethylmalonic encephalopathy protein 1
  • Hepatoma subtracted clone one protein
  • HSCOEC 3.-
  • protein ETHE1, mitochondrial
  • YF13H12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87147
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-87275
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5944
Species: Hu, Mu, Rt
Applications: WB
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33665
Species: Hu
Applications: WB
MAB72261
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
AF1379
Species: Hu
Applications: WB, IHC
NBP1-85173
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
H00000341-M01
Species: Hu
Applications: WB, ELISA

Publications for ETHE1 Antibody (NBP1-81688) (0)

There are no publications for ETHE1 Antibody (NBP1-81688).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETHE1 Antibody (NBP1-81688) (0)

There are no reviews for ETHE1 Antibody (NBP1-81688). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ETHE1 Antibody (NBP1-81688) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ETHE1 Antibody Products

Related Products by Gene

Bioinformatics Tool for ETHE1 Antibody (NBP1-81688)

Discover related pathways, diseases and genes to ETHE1 Antibody (NBP1-81688). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETHE1 Antibody (NBP1-81688)

Discover more about diseases related to ETHE1 Antibody (NBP1-81688).
 

Pathways for ETHE1 Antibody (NBP1-81688)

View related products by pathway.

PTMs for ETHE1 Antibody (NBP1-81688)

Learn more about PTMs related to ETHE1 Antibody (NBP1-81688).

Blogs on ETHE1

There are no specific blogs for ETHE1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our ETHE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETHE1

Customers Who Bought This Also Bought