ETFB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ETFB Antibody [NBP3-35630] - Immunofluorescence analysis of C6 cells using ETFB Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: ETFB Antibody [NBP3-35630] - Immunofluorescence analysis of U-2 OS cells using ETFB Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: ETFB Antibody [NBP3-35630] - Immunofluorescence analysis of L929 cells using ETFB Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: ETFB Antibody [NBP3-35630] - Western blot analysis of various lysates using ETFB Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ETFB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ETFB Antibody - BSA Free (NBP3-35630) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-230 of human ETFB (NP_001976.1).
  
  Sequence:
  AMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ETFB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ETFB Antibody - BSA Free

• beta-ETF
• electron transfer flavoprotein beta subunit
• electron transfer flavoprotein beta-subunit
• electron transfer flavoprotein subunit beta
• electron transfer flavoprotein, beta polypeptide
• electron-transfer-flavoprotein, beta polypeptide
• electron-transferring-flavoprotein, beta polypeptide
• MADD

Background

ETFB is a is an electron-transfer-flavoprotein, (beta polypeptide), and a subcomponent of Electron transfer flavoprotein (ETF). ETF exists in the mitochondrial matrix as a heterodimer of 30-kD alpha subunits (ETFA) and 28-kD beta subunits (ETFB) and contains 1 flavin adenine dinucleotide (FAD) and 1 adenosine 5-prime monophosphate (AMP) per heterodimer. This electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases and transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ETFB