ETFB Antibody


Immunocytochemistry/ Immunofluorescence: ETFB Antibody [NBP1-89455] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: ETFB Antibody [NBP1-89455] - Staining of human heart muscle shows cytoplasmic positivity with a granular pattern in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ETFB Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GLALRPPPSCLFPPDPTPSPPAGQIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQ
Specificity of human ETFB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ETFB Protein (NBP1-89455PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ETFB Antibody

  • beta-ETF
  • electron transfer flavoprotein beta subunit
  • electron transfer flavoprotein beta-subunit
  • electron transfer flavoprotein subunit beta
  • electron transfer flavoprotein, beta polypeptide
  • electron-transfer-flavoprotein, beta polypeptide
  • electron-transferring-flavoprotein, beta polypeptide
  • MADD


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ETFB Antibody (NBP1-89455) (0)

There are no publications for ETFB Antibody (NBP1-89455).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETFB Antibody (NBP1-89455) (0)

There are no reviews for ETFB Antibody (NBP1-89455). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ETFB Antibody (NBP1-89455) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ETFB Products

Bioinformatics Tool for ETFB Antibody (NBP1-89455)

Discover related pathways, diseases and genes to ETFB Antibody (NBP1-89455). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETFB Antibody (NBP1-89455)

Discover more about diseases related to ETFB Antibody (NBP1-89455).

Pathways for ETFB Antibody (NBP1-89455)

View related products by pathway.

PTMs for ETFB Antibody (NBP1-89455)

Learn more about PTMs related to ETFB Antibody (NBP1-89455).

Research Areas for ETFB Antibody (NBP1-89455)

Find related products by research area.

Blogs on ETFB

There are no specific blogs for ETFB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ETFB Antibody and receive a gift card or discount.


Gene Symbol ETFB