ETFB Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREID |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ETFB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ETFB Antibody - BSA Free
Background
ETFB is a is an electron-transfer-flavoprotein, (beta polypeptide), and a subcomponent of Electron transfer flavoprotein (ETF). ETF exists in the mitochondrial matrix as a heterodimer of 30-kD alpha subunits (ETFA) and 28-kD beta subunits (ETFB) and contains 1 flavin adenine dinucleotide (FAD) and 1 adenosine 5-prime monophosphate (AMP) per heterodimer. This electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases and transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for ETFB Antibody (NBP1-86040) (0)
There are no publications for ETFB Antibody (NBP1-86040).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ETFB Antibody (NBP1-86040) (0)
There are no reviews for ETFB Antibody (NBP1-86040).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ETFB Antibody (NBP1-86040) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ETFB Products
Research Areas for ETFB Antibody (NBP1-86040)
Find related products by research area.
|
Blogs on ETFB