ESD Antibody (1E1.)

Images

 
Western Blot: ESD Antibody (1E1) [H00002098-M01] - ESD monoclonal antibody (M01), clone 1E1. Analysis of ESD expression in Jurkat.
Sandwich ELISA: ESD Antibody (1E1) [H00002098-M01] - Detection limit for recombinant GST tagged ESD is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E1.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ESD Antibody (1E1.) Summary

Immunogen
ESD (NP_001975.1 183 a.a. - 281 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLN
Specificity
ESD - esterase D/formylglutathione hydrolase (1E1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ESD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Positive Control
ESD Lysate (NBP2-65703)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ESD Antibody (1E1.)

  • EC 3.1.2.12
  • esterase 10
  • esterase Desterase D/formylglutathione hydrolase
  • FGH
  • FLJ11763
  • S-formylglutathione hydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5075
Species: Hu, Mu, Rt
Applications: WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF2339
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00002098-M01
Species: Hu
Applications: WB, ELISA

Publications for ESD Antibody (H00002098-M01) (0)

There are no publications for ESD Antibody (H00002098-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ESD Antibody (H00002098-M01) (0)

There are no reviews for ESD Antibody (H00002098-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ESD Antibody (H00002098-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ESD Antibody (H00002098-M01)

Discover related pathways, diseases and genes to ESD Antibody (H00002098-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ESD Antibody (H00002098-M01)

Discover more about diseases related to ESD Antibody (H00002098-M01).
 

Pathways for ESD Antibody (H00002098-M01)

View related products by pathway.

PTMs for ESD Antibody (H00002098-M01)

Learn more about PTMs related to ESD Antibody (H00002098-M01).

Blogs on ESD

There are no specific blogs for ESD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ESD Antibody (1E1.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ESD
Entrez
Uniprot