ESAM Antibody - BSA Free

Immunohistochemistry-Paraffin: ESAM Antibody [NBP2-33780] - Staining of human bronchus shows moderate cytoplasmic positivity in respiratory epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ESAM Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ESAM Antibody - BSA Free (NBP2-33780) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ESAM
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ESAM Recombinant Protein Antigen (NBP2-33780PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ESAM Antibody - BSA Free

• 2310008D05Rik
• endothelial cell adhesion molecule
• endothelial cell-selective adhesion molecule
• ESAM
• HUEL (C4orf1)-interacting protein
• LP4791 protein
• W117m

Background

ESAM is a tight junction regulatory protein involved in cell adhesion and is expressed only on endothelial cells and activated platelets. It may mediate aggregation through a homophilic molecular interaction (By similarity). ESAM at endothelial tight junctions participates in the migration of neutrophils through the vessel walls and it may have a role in signaling mechanisms that trigger the opening of endothelial cell contacts. A correlation has been found between ESAM expression and lymph node metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ESAM
• Uniprot:
  • Q96AP7()