Recombinant Human ERR gamma/NR3B3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ERR gamma/NR3B3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-435 of Human ESRRG full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

Protein/Peptide Type
Recombinant Protein
Gene
ESRRG

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ERR gamma/NR3B3 Protein

  • DKFZp781L1617
  • ERR gamma
  • ERR gamma-2
  • ERR3
  • ERRG2
  • ERRgamma
  • ESRRG
  • Estrogen receptor-related protein 3
  • estrogen-related receptor gamma
  • FLJ16023
  • KIAA0832
  • NR3B3
  • Nuclear receptor subfamily 3 group B member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46522
Species: Hu
Applications: WB, IHC
NB300-748
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00002104-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for ERR gamma/NR3B3 Recombinant Protein (H00002104-P02) (0)

There are no publications for ERR gamma/NR3B3 Recombinant Protein (H00002104-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERR gamma/NR3B3 Recombinant Protein (H00002104-P02) (0)

There are no reviews for ERR gamma/NR3B3 Recombinant Protein (H00002104-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERR gamma/NR3B3 Recombinant Protein (H00002104-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERR gamma/NR3B3 Products

Bioinformatics Tool for ERR gamma/NR3B3 Recombinant Protein (H00002104-P02)

Discover related pathways, diseases and genes to ERR gamma/NR3B3 Recombinant Protein (H00002104-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERR gamma/NR3B3 Recombinant Protein (H00002104-P02)

Discover more about diseases related to ERR gamma/NR3B3 Recombinant Protein (H00002104-P02).
 

Pathways for ERR gamma/NR3B3 Recombinant Protein (H00002104-P02)

View related products by pathway.

PTMs for ERR gamma/NR3B3 Recombinant Protein (H00002104-P02)

Learn more about PTMs related to ERR gamma/NR3B3 Recombinant Protein (H00002104-P02).
 

Research Areas for ERR gamma/NR3B3 Recombinant Protein (H00002104-P02)

Find related products by research area.

Blogs on ERR gamma/NR3B3

There are no specific blogs for ERR gamma/NR3B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ERR gamma/NR3B3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ESRRG
Entrez