ERR gamma/NR3B3 Recombinant Protein Antigen

Images

 
There are currently no images for ERR gamma/NR3B3 Protein (NBP1-91873PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ERR gamma/NR3B3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ESRRG.

Source: E. coli

Amino Acid Sequence: SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ESRRG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91873.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ERR gamma/NR3B3 Recombinant Protein Antigen

  • DKFZp781L1617
  • ERR gamma
  • ERR gamma-2
  • ERR3
  • ERRG2
  • ERRgamma
  • ESRRG
  • Estrogen receptor-related protein 3
  • estrogen-related receptor gamma
  • FLJ16023
  • KIAA0832
  • NR3B3
  • Nuclear receptor subfamily 3 group B member 3

Background

Estrogen related receptor (ERR gamma), a NR3 Steroid Receptor is an orphan member of the nuclear hormone receptor superfamily. All the ERR family members (1,2, and 3) share an almost identical DNA binding domain, which has 68% amino acid identity with that of estrogen receptor. Studies involving the crystal structure of the LBD have shown a complex between ERR3 and SRC1. ERR gamma has been suggested to affect differentiation of the brain, heart, and kidney. ERR gamma binds as a monomer to an extended half site of the ERRE type (TCAAGGTCA). ERR gamma has been shown to interact with PGC1 alpha and has been implicated in the regulation of mitochondrial energy metabolism. In humans, ERR gamma pre mRNA undergoes extensive alternative splicing at the 5 prime end, yielding at least six mRNA splice variants and two protein isoforms that differ by 23 amino acids in the N terminus. ERR gamma has been shown to be overexpressed in breast tumors, and its expression is correlated with levels of ErbB4, a likely indicator of preferred clinical course. As a result, ERR gamma has been suggested to be a potential biomarker for favorable clinical course and, possibly, hormonal sensitivity, and as a candidate target for therapeutic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47254
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35470
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NLS5411
Species: Ha, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P
PP-H6705-00
Species: Hu
Applications: IHC, IP, WB
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-13674
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB200-305
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-91873PEP
Species: Hu
Applications: AC

Publications for ERR gamma/NR3B3 Protein (NBP1-91873PEP) (0)

There are no publications for ERR gamma/NR3B3 Protein (NBP1-91873PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERR gamma/NR3B3 Protein (NBP1-91873PEP) (0)

There are no reviews for ERR gamma/NR3B3 Protein (NBP1-91873PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ERR gamma/NR3B3 Protein (NBP1-91873PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERR gamma/NR3B3 Products

Research Areas for ERR gamma/NR3B3 Protein (NBP1-91873PEP)

Find related products by research area.

Blogs on ERR gamma/NR3B3

There are no specific blogs for ERR gamma/NR3B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ERR gamma/NR3B3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ESRRG