ERR gamma/NR3B3 Antibody

Images

 
Western Blot: ERR gamma/NR3B3 Antibody [H00002104-B01P] - Analysis of ESRRG expression in transfected 293T cell line by ESRRG polyclonal antibody. Lane 1: ESRRG transfected lysate(47.85 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ERR gamma/NR3B3 Antibody Summary

Immunogen
ESRRG (NP_996317.1, 1 a.a. - 435 a.a.) full-length human protein. MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ESRRG
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ERR gamma/NR3B3 Antibody

  • DKFZp781L1617
  • ERR gamma
  • ERR gamma-2
  • ERR3
  • ERRG2
  • ERRgamma
  • ESRRG
  • Estrogen receptor-related protein 3
  • estrogen-related receptor gamma
  • FLJ16023
  • KIAA0832
  • NR3B3
  • Nuclear receptor subfamily 3 group B member 3

Background

Estrogen related receptor (ERR gamma), a NR3 Steroid Receptor is an orphan member of the nuclear hormone receptor superfamily. All the ERR family members (1,2, and 3) share an almost identical DNA binding domain, which has 68% amino acid identity with that of estrogen receptor. Studies involving the crystal structure of the LBD have shown a complex between ERR3 and SRC1. ERR gamma has been suggested to affect differentiation of the brain, heart, and kidney. ERR gamma binds as a monomer to an extended half site of the ERRE type (TCAAGGTCA). ERR gamma has been shown to interact with PGC1 alpha and has been implicated in the regulation of mitochondrial energy metabolism. In humans, ERR gamma pre mRNA undergoes extensive alternative splicing at the 5 prime end, yielding at least six mRNA splice variants and two protein isoforms that differ by 23 amino acids in the N terminus. ERR gamma has been shown to be over expressed in breast tumors, and its expression is correlated with levels of ErbB4, a likely indicator of preferred clinical course. As a result, ERR gamma has been suggested to be a potential biomarker for favorable clinical course and, possibly, hormonal sensitivity, and as a candidate target for therapeutic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46522
Species: Hu
Applications: WB, IHC
NB300-748
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00002104-B01P
Species: Hu
Applications: WB

Publications for ERR gamma/NR3B3 Antibody (H00002104-B01P) (0)

There are no publications for ERR gamma/NR3B3 Antibody (H00002104-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERR gamma/NR3B3 Antibody (H00002104-B01P) (0)

There are no reviews for ERR gamma/NR3B3 Antibody (H00002104-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERR gamma/NR3B3 Antibody (H00002104-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERR gamma/NR3B3 Products

Bioinformatics Tool for ERR gamma/NR3B3 Antibody (H00002104-B01P)

Discover related pathways, diseases and genes to ERR gamma/NR3B3 Antibody (H00002104-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERR gamma/NR3B3 Antibody (H00002104-B01P)

Discover more about diseases related to ERR gamma/NR3B3 Antibody (H00002104-B01P).
 

Pathways for ERR gamma/NR3B3 Antibody (H00002104-B01P)

View related products by pathway.

PTMs for ERR gamma/NR3B3 Antibody (H00002104-B01P)

Learn more about PTMs related to ERR gamma/NR3B3 Antibody (H00002104-B01P).
 

Research Areas for ERR gamma/NR3B3 Antibody (H00002104-B01P)

Find related products by research area.

Blogs on ERR gamma/NR3B3

There are no specific blogs for ERR gamma/NR3B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERR gamma/NR3B3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ESRRG
Entrez
Uniprot