Recombinant Human ERP29 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ERP29 Protein Summary

Description
ERP29 (Human) GST-Tagged Recombinant Protein (P01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
ERP29

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ERP29 Protein

  • C12orf8chromosome 12 open reading frame 8
  • endoplasmic reticulum lumenal protein ERp28
  • endoplasmic reticulum protein 29
  • Endoplasmic reticulum resident protein 28
  • endoplasmic reticulum resident protein 29
  • ERp28Endoplasmic reticulum resident protein 31
  • ERp29
  • ERp31ERP28
  • PDIA9
  • PDI-DB
  • protein disulfide isomerase family A, member 9

Background

This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF1543
Species: Hu
Applications: WB, IHC
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87283
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01652
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
H00010961-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ERP29 Recombinant Protein (H00010961-P01) (0)

There are no publications for ERP29 Recombinant Protein (H00010961-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERP29 Recombinant Protein (H00010961-P01) (0)

There are no reviews for ERP29 Recombinant Protein (H00010961-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERP29 Recombinant Protein (H00010961-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERP29 Products

Bioinformatics Tool for ERP29 Recombinant Protein (H00010961-P01)

Discover related pathways, diseases and genes to ERP29 Recombinant Protein (H00010961-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERP29 Recombinant Protein (H00010961-P01)

Discover more about diseases related to ERP29 Recombinant Protein (H00010961-P01).
 

Pathways for ERP29 Recombinant Protein (H00010961-P01)

View related products by pathway.

PTMs for ERP29 Recombinant Protein (H00010961-P01)

Learn more about PTMs related to ERP29 Recombinant Protein (H00010961-P01).
 

Research Areas for ERP29 Recombinant Protein (H00010961-P01)

Find related products by research area.

Blogs on ERP29

There are no specific blogs for ERP29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ERP29 Antibody
NBP1-33076
ERP29 Antibody
NBP1-33076
ERP29 Antibody
NBP1-33076

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ERP29 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ERP29