ERG Antibody (5H6X10)

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clone: 5H6X10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ERG Antibody (5H6X10) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERG (NP_891548.1).
  
  Sequence:
  MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ERG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for ERG Antibody (5H6X10)

• transcriptional regulator ERG
• 10ets-related
• Erg
• Erg-3
• p55
• TMPRSS2-ERG prostate cancer specific
• transcriptional regulator ERG
• Transforming protein ERG
• v-ets erythroblastosis virus E26 oncogene homolog (avian)
• v-ets erythroblastosis virus E26 oncogene like (avian)
• v-ets erythroblastosis virus E26 oncogene like

Background

"ERG is a transcriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for ERG Antibody (NBP3-33339). (Showing 1 - 1 of 1 FAQ).

1. I am looking for an antibody that can IP Erg protein and doesn't cross react with Fli protein.
   • I have spoken to the lab and they have informed me that actually that the antibody (catalog #NBP1-95857) is confirmed not to cross react with Fli1 protein so it should be a viable choice for you in your experiments on Erg.

Bioinformatics

• Gene Symbol: ERG