Erbin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKETDSLSDEVTHNSNQNNSNCSSPS |
| Predicted Species |
Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ERBIN |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Knockdown Validated
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Erbin Antibody - BSA Free
Background
The ERBB2IP gene encodes a LAP2 protein that exists in nine isoforms: Isoform 1: 1,412 amino acids long, 158 kDA; isoform 2: 1,371 amino acids long, 153 kDA; isoform 3: 1,360 amino acids long, 152 kDA; isoform 4: 1,346 amino acids, 151 kDA; isoform 5: 1,356 amino acids long, 152 kDA; isoform 6: 1,340 amino acids long, 150 kDA; isoform 7: 1,302 amino acids long, 146 kDA; isoform 8: 1,419 amino acids long, 159 kDA; isoform 9 is 1,367 amino acids long at 153 kDA. ERBB2IP functions as an adapter for the receptor ERBB2, and through binding of this receptor, it contributes to the stabilization of this unphosphorylated state. ERBB2IP participates in the NOD pathway, TGF-beta receptor signaling pathway, signal transduction, and with NLR proteins. It is known to interact with genes PKP4, SMAD3, ERBB2, ZFYVE9, and CTNNB1. ERBB2IP is associated with breast cancer, carcinoma, cervical cancer, crohn's disease, and epidermolysis bullosa.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Publications for Erbin Antibody (NBP2-56104)(1)
Showing Publication 1 -
1 of 1.
| Publication using NBP2-56104 |
Applications |
Species |
| Fang, Q;Jing, G;Zhang, Y;Wang, H;Luo, H;Xia, Y;Jin, Q;Liu, Y;Zuo, J;Yang, C;Zhang, X;Liu, S;Wu, X;Song, X; Erbin accelerates TFEB-mediated lysosome biogenesis and autophagy and alleviates sepsis-induced inflammatory responses and organ injuries Journal of translational medicine 2023-12-17 [PMID: 38105228] |
|
|
Reviews for Erbin Antibody (NBP2-56104) (0)
There are no reviews for Erbin Antibody (NBP2-56104).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Erbin Antibody (NBP2-56104) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Erbin Products
Blogs on Erbin