ErbB2/Her2 Antibody

Images

 
Western Blot: ErbB2/Her2 Antibody [NBP1-84584] - Analysis in human cell line SK-BR-3.
Immunocytochemistry/ Immunofluorescence: ErbB2/Her2 Antibody [NBP1-84584] - Immunofluorescent staining of human cell line MCF7 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human urinary bladder shows moderate membranous and cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ErbB2/Her2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERBB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ErbB2/Her2 Recombinant Protein Antigen (NBP1-84584PEP)
Publications
Read Publications using
NBP1-84584 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (81%). Reactivity reported in scientific literature (PMID: 23777659)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ErbB2/Her2 Antibody

  • CD340 antigen
  • CD340
  • c-erb B2/neu protein
  • EC 2.7.10
  • EGFR2
  • ErbB2
  • HER2
  • HER-2
  • HER2EC 2.7.10.1
  • herstatin
  • Metastatic lymph node gene 19 protein
  • MLN 19
  • MLN19
  • Neu Oncogene
  • NEUHER-2/neu
  • neuroblastoma/glioblastoma derived oncogene homolog
  • NGL
  • NGLTKR1
  • p185erbB2
  • Proto-oncogene c-ErbB-2
  • Proto-oncogene Neu
  • receptor tyrosine-protein kinase erbB-2
  • TKR1
  • Tyrosine kinase-type cell surface receptor HER2
  • v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog)
  • v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-46403
Species: Hu
Applications: IHC
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-84584
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ErbB2/Her2 Antibody (NBP1-84584)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ErbB2/Her2 Antibody (NBP1-84584) (0)

There are no reviews for ErbB2/Her2 Antibody (NBP1-84584). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ErbB2/Her2 Antibody (NBP1-84584). (Showing 1 - 1 of 1 FAQs).

  1. I am interested in getting antibodies for HER that would work in flow cytometry. Could you recommend some choices?
    • A list of our ErbB2 antibodies validated for use in flow cytometry can be found here /productsearch/HER2#fq=common_name%3A%22ErbB2%2FHER2%22&fq=category%3A%22Primary%20Antibodies%22&fq=applications%3A%22Flow%20Cytometry%22

Secondary Antibodies

 

Isotype Controls

Additional ErbB2/Her2 Products

Bioinformatics Tool for ErbB2/Her2 Antibody (NBP1-84584)

Discover related pathways, diseases and genes to ErbB2/Her2 Antibody (NBP1-84584). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ErbB2/Her2 Antibody (NBP1-84584)

Discover more about diseases related to ErbB2/Her2 Antibody (NBP1-84584).
 

Pathways for ErbB2/Her2 Antibody (NBP1-84584)

View related products by pathway.

PTMs for ErbB2/Her2 Antibody (NBP1-84584)

Learn more about PTMs related to ErbB2/Her2 Antibody (NBP1-84584).

Blogs on ErbB2/Her2

There are no specific blogs for ErbB2/Her2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ErbB2/Her2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERBB2
Entrez