EPX Antibody

Images

 
Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human duodenum shows moderate cytoplasmic positivity in some peripheral leukocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining in human bone marrow and skeletal muscle tissues. Corresponding EPX RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

EPX Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKS
Specificity
Specificity of human EPX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EPX Protein (NBP2-13967PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPX Antibody

  • EC 1.11.1.7
  • eosinophil peroxidase
  • EPOEPER
  • EPPEC 1.11.1
  • EPX-PEN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19388
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA

Publications for EPX Antibody (NBP2-13967) (0)

There are no publications for EPX Antibody (NBP2-13967).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPX Antibody (NBP2-13967) (0)

There are no reviews for EPX Antibody (NBP2-13967). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EPX Antibody (NBP2-13967) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPX Products

EPX NBP2-13967

Bioinformatics Tool for EPX Antibody (NBP2-13967)

Discover related pathways, diseases and genes to EPX Antibody (NBP2-13967). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPX Antibody (NBP2-13967)

Discover more about diseases related to EPX Antibody (NBP2-13967).
 

Pathways for EPX Antibody (NBP2-13967)

View related products by pathway.

PTMs for EPX Antibody (NBP2-13967)

Learn more about PTMs related to EPX Antibody (NBP2-13967).

Blogs on EPX

There are no specific blogs for EPX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPX