EPX Antibody

Western Blot: EPX Antibody [NBP2-13967] - Analysis in human cell line NB4.

Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human duodenum shows moderate cytoplasmic positivity in some peripheral leukocytes.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

EPX Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EPX Protein (NBP2-13967PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EPX Antibody

• EC 1.11.1.7
• eosinophil peroxidase
• EPOEPER
• EPPEC 1.11.1
• EPX-PEN

Background

The EPX gene is a member of the peroxidase gene family and is expressed in eosinophils. The encoded precursor protein is processed into covalently attached heavy and light chains to form the mature enzyme, which functions as an oxidant. The enzyme is release

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPX Antibody (NBP2-13967)(1)

Publication using NBP2-13967

• Lee WY, Weinberg OK, Pinkus GS. GATA1 Is a Sensitive and Specific Nuclear Marker for Erythroid and Megakaryocytic Lineages Am. J. Clin. Pathol. 2017-04-01 [PMID: 28340113] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: EPX