epithelial Sodium Channel beta Antibody

Images

 
Western Blot: epithelial Sodium Channel beta Antibody [NBP1-84844] - Analysis in control (vector only transfected HEK293T lysate) and sCNN1B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) ...read more
Immunohistochemistry-Paraffin: epithelial Sodium Channel beta Antibody [NBP1-84844] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

epithelial Sodium Channel beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCNN1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
epithelial Sodium Channel beta Protein (NBP1-84844PEP)
Publications
Read Publication using
NBP1-84844 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%). Human reactivity reported in scientific literature (PMID: 26230923).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for epithelial Sodium Channel beta Antibody

  • amiloride-sensitive sodium channel subunit beta 1
  • amiloride-sensitive sodium channel subunit beta
  • BESC1
  • beta-ENaC
  • beta-NaCH
  • ENaCb
  • ENaCbeta
  • Epithelial Na(+) channel subunit beta
  • epithelial sodium channel beta-2 subunit
  • epithelial sodium channel beta-3 subunit
  • nasal epithelial sodium channel beta subunit
  • Nonvoltage-gated sodium channel 1 subunit beta
  • SCNEB
  • sodium channel, nonvoltage-gated 1, beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41371
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, S-ELISA, ELISA(Cap)
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP1-83258
Species: Hu
Applications: IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-54974
Species: Hu
Applications: WB
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NBP1-85004
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84844
Species: Hu
Applications: WB, IHC, IHC-P

Publications for epithelial Sodium Channel beta Antibody (NBP1-84844)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for epithelial Sodium Channel beta Antibody (NBP1-84844) (0)

There are no reviews for epithelial Sodium Channel beta Antibody (NBP1-84844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for epithelial Sodium Channel beta Antibody (NBP1-84844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional epithelial Sodium Channel beta Products

Bioinformatics Tool for epithelial Sodium Channel beta Antibody (NBP1-84844)

Discover related pathways, diseases and genes to epithelial Sodium Channel beta Antibody (NBP1-84844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for epithelial Sodium Channel beta Antibody (NBP1-84844)

Discover more about diseases related to epithelial Sodium Channel beta Antibody (NBP1-84844).
 

Pathways for epithelial Sodium Channel beta Antibody (NBP1-84844)

View related products by pathway.

PTMs for epithelial Sodium Channel beta Antibody (NBP1-84844)

Learn more about PTMs related to epithelial Sodium Channel beta Antibody (NBP1-84844).

Blogs on epithelial Sodium Channel beta

There are no specific blogs for epithelial Sodium Channel beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our epithelial Sodium Channel beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1B