epithelial Sodium Channel beta Antibody - BSA Free

Immunohistochemistry-Paraffin: epithelial Sodium Channel beta Antibody [NBP1-84844] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and sCNN1B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424793).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

epithelial Sodium Channel beta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCNN1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  epithelial Sodium Channel beta Protein (NBP1-84844PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for epithelial Sodium Channel beta Antibody - BSA Free

• amiloride-sensitive sodium channel subunit beta 1
• amiloride-sensitive sodium channel subunit beta
• BESC1
• Beta-ENaC
• Beta-NaCH
• ENaCB
• ENaCbeta
• Epithelial Na(+) channel subunit beta
• epithelial Sodium Channel beta
• epithelial sodium channel beta-2 subunit
• epithelial sodium channel beta-3 subunit
• nasal epithelial sodium channel beta subunit
• Nonvoltage-gated sodium channel 1 subunit beta
• SCNEB
• SCNN1B
• sodium channel, nonvoltage-gated 1, beta

Background

SCNN1B is a subunit of the epithelial sodium channel, ENaC. ENac has high sodium selectivity, low conductance, and amiloride sensitivity. The functional channel of ENaC is composed of at least 3 subunits, alpha (SCNN1A), beta (SCNN1B), and gamma (SCNN1G). The 3 subunits show sequence similarities to one another, indicating descent from a common ancestral gene. Each encodes a protein containing 2 transmembrane domains, with intracellular amino and carboxyl termini. ENaC in the kidney, lung and colon plays an essential role in trans- epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium re-uptake in the distal nephron of the kidney, thus regulating blood pressure. Mutations in beta or gamma subunit of the epithelial sodium channel (ENaC) have been found to cause a hereditary form of human hypertension, Liddle syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for epithelial Sodium Channel beta Antibody (NBP1-84844)(1)

Publication using NBP1-84844

• Baras AS, Gandhi N, Munari E et al. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. PLoS One 2015-01-01 [PMID: 26230923] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: SCNN1B