ACCN5 Antibody - BSA Free

Staining of human cerebellum shows no positivity as expected.

Staining of human pancreas shows no positivity as expected.

Staining of human kidney shows no positivity as expected.

Staining of human duodenum shows strong positivity in apical membrane in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACCN5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACCN5 Antibody - BSA Free (NBP1-83258) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASIC5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ACCN5 Protein (NBP1-83258PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ACCN5 Antibody - BSA Free

• amiloride-sensitive cation channel 5, intestinal

Background

The ACCN5 gene belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primari

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASIC5
• Entrez:
  • 51802(Human)
• Uniprot:
  • Q9NY37(Human)