SCNN1D Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SCNN1D Antibody [NBP1-85004] - Staining of human cell line U-2 OS shows localization to plasma membrane and actin filaments.
Immunohistochemistry-Paraffin: SCNN1D Antibody [NBP1-85004] - Staining in human testis and pancreas tissues using anti-SCNN1D antibody. Corresponding SCNN1D RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SCNN1D Antibody [NBP1-85004] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SCNN1D Antibody [NBP1-85004] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCNN1D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGLDCQARQFRTFHHPTYGSCYTVDG
Specificity
Specificity of human SCNN1D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCNN1D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCNN1D Protein (NBP1-85004PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCNN1D Antibody

  • Delta-ENaC
  • Delta-NaCH
  • DNACH
  • ENaCd
  • MGC149710
  • MGC149711
  • SCNED
  • sodium channel, nonvoltage-gated 1, delta
  • voltage-gated, type I, delta polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74357
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-84844
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22409
Species: Mu
Applications: WB, ICC/IF, IHC
NBP2-41373
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30876
Species: Hu
Applications: IHC, IHC-P
NBP1-51645
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-14321
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24479
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-14843
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-146
Species: Hu, Mu, Rt, Po, Bv, Ca, Dr, GP, Pm, Rb, Xp, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1555
Species: Hu
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-76289
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
NBP1-36975
Species: Ha(-)
Applications: ICC/IF, PEP-ELISA
AF482
Species: Mu
Applications: WB, IHC

Publications for SCNN1D Antibody (NBP1-85004) (0)

There are no publications for SCNN1D Antibody (NBP1-85004).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCNN1D Antibody (NBP1-85004) (0)

There are no reviews for SCNN1D Antibody (NBP1-85004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SCNN1D Antibody (NBP1-85004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SCNN1D Antibody (NBP1-85004)

Discover related pathways, diseases and genes to SCNN1D Antibody (NBP1-85004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCNN1D Antibody (NBP1-85004)

Discover more about diseases related to SCNN1D Antibody (NBP1-85004).
 

Pathways for SCNN1D Antibody (NBP1-85004)

View related products by pathway.

PTMs for SCNN1D Antibody (NBP1-85004)

Learn more about PTMs related to SCNN1D Antibody (NBP1-85004).

Blogs on SCNN1D

There are no specific blogs for SCNN1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCNN1D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1D