EphA8 Antibody - BSA Free

Immunohistochemistry-Paraffin: EphA8 Antibody [NBP1-84893] - Staining of human small intestine shows strong membranous positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EphA8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EphA8 Antibody - BSA Free (NBP1-84893) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSG
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPHA8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EphA8 Protein (NBP1-84893PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EphA8 Antibody - BSA Free

• Eek
• EK3
• EPH- and ELK-related kinase
• EPH- and ELK-related tyrosine kinase
• EPH receptor A8
• EphA8
• EPH-like kinase 3
• ephrin type-A receptor 8
• Hek3
• hydroxyaryl-protein kinase
• KIAA1459
• protein-tyrosine kinase
• tyrosine-protein kinase receptor EEK
• tyrosylprotein kinase

Background

The EPH receptor A8 gene encodes a member of the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-relatedreceptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in theEPH subfamily typic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPHA8