EPB41L1 Antibody (2D10)

Images

 
ELISA: EPB41L1 Antibody (2D10) [H00002036-M09] - Detection limit for recombinant GST tagged EPB41L1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EPB41L1 Antibody (2D10) Summary

Immunogen
EPB41L1 (NP_818932, 1 a.a. - 88 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKN
Specificity
EPB41L1 - erythrocyte membrane protein band 4.1-like 1 (2D10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EPB41L1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EPB41L1 Antibody (2D10)

  • band 4.1-like protein 1
  • DKFZp686H17242
  • erythrocyte membrane protein band 4.1-like 1
  • KIAA0338Neuronal protein 4.1,4.1N
  • MGC11072
  • neuron-type nonerythroid protein 4.1

Background

Erythrocyte membrane protein band 4.1 (EPB41) is a multifunctional protein that mediates interactions between the erythrocyte cytoskeleton and the overlying plasma membrane. The protein encoded by this gene is a neuronally-enriched protein that is structurally similar to EPB41. The encoded protein binds and stabilizes D2 and D3 dopamine receptors at the neuronal plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
NBP1-90325
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002036-M09
Species: Hu
Applications: WB, ELISA

Publications for EPB41L1 Antibody (H00002036-M09) (0)

There are no publications for EPB41L1 Antibody (H00002036-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB41L1 Antibody (H00002036-M09) (0)

There are no reviews for EPB41L1 Antibody (H00002036-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EPB41L1 Antibody (H00002036-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EPB41L1 Products

Bioinformatics Tool for EPB41L1 Antibody (H00002036-M09)

Discover related pathways, diseases and genes to EPB41L1 Antibody (H00002036-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPB41L1 Antibody (H00002036-M09)

Discover more about diseases related to EPB41L1 Antibody (H00002036-M09).
 

Pathways for EPB41L1 Antibody (H00002036-M09)

View related products by pathway.

PTMs for EPB41L1 Antibody (H00002036-M09)

Learn more about PTMs related to EPB41L1 Antibody (H00002036-M09).

Blogs on EPB41L1

There are no specific blogs for EPB41L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPB41L1 Antibody (2D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB41L1
Entrez
Uniprot