Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody - BSA Free (NBP3-17840) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HSPG2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody - BSA Free
Background
Perlecan is an extracellular matrix proteoglycan. It has a large core protein of 400-450 kDa and is often produced with heparan sulfate side chains. Perlecan is found in basement membranes where it contributes to the permeability characteristics, serves as a substrate for vascular cells and binds growth factors involved in vascular remodeling (2).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC
Publications for Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (NBP3-17840) (0)
There are no publications for Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (NBP3-17840).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (NBP3-17840) (0)
There are no reviews for Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (NBP3-17840).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (NBP3-17840) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Products
Research Areas for Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (NBP3-17840)
Find related products by research area.
|
Blogs on Endorepellin/Perlecan/Heparan Sulfate Proteoglycan