ENC1 Antibody (3B1) - Azide and BSA Free

Western Blot: ENC1 Antibody (3B1) [H00008507-M02] - ENC1 monoclonal antibody (M02), clone 3B1 Analysis of ENC1 expression in IMR-32.

Sandwich ELISA: ENC1 Antibody (3B1) [H00008507-M02] - Detection limit for recombinant GST tagged ENC1 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3B1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ENC1 Antibody (3B1) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ENC1 (NP_003624, 17 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL
• Specificity: ENC1 - ectodermal-neural cortex (with BTB-like domain)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ENC1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ENC1 Antibody (3B1) - Azide and BSA Free

• CCL28
• ectodermal-neural cortex 1 (with BTB-like domain)
• ENC-1BTB domain-like (brain)
• FLJ39259
• PIG10KLHL35
• tumor protein p53 inducible protein 10

Background

DNA damage and/or hyperproliferative signals activate wildtype p53 tumor suppressor protein (TP53; MIM 191170), inducing cell cycle arrest or apoptosis. Mutations that inactivate p53 occur in 50% of all tumors. Polyak et al. (1997) [PubMed 9305847] used serial analysis of gene expression (SAGE) to evaluate cellular mRNA levels in a colorectal cancer cell line transfected with p53. Of 7,202 transcripts identified, only 14 were expressed at levels more than 10-fold higher in p53-expressing cells than in control cells. Polyak et al. (1997) [PubMed 9305847] termed these genes 'p53-induced genes,' or PIGs, several of which were predicted to encode redox-controlling proteins. They noted that reactive oxygen species (ROS) are potent inducers of apoptosis. Flow cytometric analysis showed that p53 expression induces ROS production, which increases as apoptosis progresses under some conditions. The authors stated that the PIG10 gene, also called ENC1, encodes an actin-binding protein.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ENC1 Antibody (H00008507-M02)(1)

Publication using H00008507-M02

• Durand J, Lampron A, Mazzuco TL et al. Characterization of Differential Gene Expression in Adrenocortical Tumors Harboring {beta}-Catenin (CTNNB1) Mutations. J Clin Endocrinol Metab. 2011-05-11 [PMID: 21565795]

Bioinformatics

• Gene Symbol: ENC1
• Entrez:
  • 8507(Human)
• OMIM:
  • 605173(Human)
• Uniprot:
  • NP_003624(Human)