EMMPRIN/CD147 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit EMMPRIN/CD147 Antibody - BSA Free (NBP2-34025) is a polyclonal antibody validated for use in IHC, WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: DLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIEN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
BSG |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
- Simple Western
- Western Blot 1:100 - 1:250
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Simple Western Separated by size; matrix was 12-230 kDa; detected by Chemiluminescence. See Simple Western Antibody Database for Simple Western validation: separated by Size |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for EMMPRIN/CD147 Antibody - BSA Free
Background
CD147 plays a pivotal role in spermatogenesis, embryo implantation, neural network formation and tumor progression. It stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). CD147 may target monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to plasma membranes of retinal pigment epithelium and neural retina. CD147 also seems to be a receptor for oligomannosidic glycans. In vitro, it promotes outgrowth of astrocytic processes. CD147 forms homooligomers in a cis-dependent manner on the plasma membrane. It forms a complex with MMP1 at the tumor cell surface. CD147 interacts with SLC16A1 and SLC1A3; probably a BSG dimer is associated with a monocarboxylate transporter dimer. CD147 also interacts with ATP1B2, MAG and L1CAM.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IP, KO, Neut, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB, Simple Western, IHC
Publications for EMMPRIN/CD147 Antibody (NBP2-34025) (0)
There are no publications for EMMPRIN/CD147 Antibody (NBP2-34025).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EMMPRIN/CD147 Antibody (NBP2-34025) (0)
There are no reviews for EMMPRIN/CD147 Antibody (NBP2-34025).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EMMPRIN/CD147 Antibody (NBP2-34025) (0)