EMID2 Antibody (NBP1-62711)

Images

 
Western Blot: EMID2 Antibody [NBP1-62711] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EMID2 Antibody Summary

Immunogen
Synthetic peptides corresponding to EMID2(EMI domain containing 2) The peptide sequence was selected form the C terminal of EMID2. Peptide sequence GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EMID2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This is a rabbit polyclonal antibody against EMID2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EMID2 Antibody

  • COL26A1
  • EMI domain containing 2
  • EMI domain-containing protein 2
  • Emilin and multimerin domain-containing protein 2
  • emilin and multimerin-domain containing protein 2
  • EMU2
  • Emu2type XXVI, alpha 1
  • hEmu2
  • KIAA1299
  • MGC129848
  • putative emu2
  • SH2B
  • SH2B1

Background

EMID2 contains 1 EMI domain and 2 collagen-like domains. The exact function of ZCCHC3 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00641
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6915
Species: Hu, Mu, Rt
Applications: WB
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-13305
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
H00004068-M01
Species: Hu
Applications: WB, ELISA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-83977
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-84127
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for EMID2 Antibody (NBP1-62711) (0)

There are no publications for EMID2 Antibody (NBP1-62711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMID2 Antibody (NBP1-62711) (0)

There are no reviews for EMID2 Antibody (NBP1-62711). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMID2 Antibody (NBP1-62711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EMID2 Products

Related Products by Gene

Bioinformatics Tool for EMID2 Antibody (NBP1-62711)

Discover related pathways, diseases and genes to EMID2 Antibody (NBP1-62711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMID2 Antibody (NBP1-62711)

Discover more about diseases related to EMID2 Antibody (NBP1-62711).
 

Pathways for EMID2 Antibody (NBP1-62711)

View related products by pathway.

Blogs on EMID2

There are no specific blogs for EMID2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EMID2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EMID2
OMIM
Uniprot

Customers Who Bought This Also Bought