EMID2 Antibody


Western Blot: EMID2 Antibody [NBP1-62711] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

EMID2 Antibody Summary

Synthetic peptides corresponding to EMID2(EMI domain containing 2) The peptide sequence was selected form the C terminal of EMID2. Peptide sequence GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
This is a rabbit polyclonal antibody against EMID2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EMID2 Antibody

  • COL26A1
  • EMI domain containing 2
  • EMI domain-containing protein 2
  • Emilin and multimerin domain-containing protein 2
  • emilin and multimerin-domain containing protein 2
  • EMU2
  • Emu2type XXVI, alpha 1
  • hEmu2
  • KIAA1299
  • MGC129848
  • putative emu2
  • SH2B
  • SH2B1


EMID2 contains 1 EMI domain and 2 collagen-like domains. The exact function of ZCCHC3 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Rt

Publications for EMID2 Antibody (NBP1-62711) (0)

There are no publications for EMID2 Antibody (NBP1-62711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMID2 Antibody (NBP1-62711) (0)

There are no reviews for EMID2 Antibody (NBP1-62711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EMID2 Antibody (NBP1-62711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for EMID2 Antibody (NBP1-62711)

Discover related pathways, diseases and genes to EMID2 Antibody (NBP1-62711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMID2 Antibody (NBP1-62711)

Discover more about diseases related to EMID2 Antibody (NBP1-62711).

Pathways for EMID2 Antibody (NBP1-62711)

View related products by pathway.

Blogs on EMID2

There are no specific blogs for EMID2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EMID2 Antibody and receive a gift card or discount.


Gene Symbol EMID2