EMG1 Antibody - BSA Free

Immunohistochemistry-Paraffin: EMG1 Antibody [NBP2-54688] - Staining of human oral mucosa shows moderate nucleolar positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EMG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EMG1 Antibody - BSA Free (NBP2-54688) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids: SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EMG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EMG1 Recombinant Protein Antigen (NBP2-54688PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EMG1 Antibody - BSA Free

• 18S rRNA (pseudouridine-N1-)-methyltransferase NEP1
• BWCNS
• C2F18S rRNA Psi1248 methyltransferase
• EMG1 nucleolar protein homolog (S. cerevisiae)
• essential for mitotic growth 1
• FLJ60792
• Grcc2f
• NEP1EC 2.1.1.-
• Nucleolar protein EMG1 homolog
• probable ribosome biogenesis protein NEP1
• Protein C2f
• Ribosome biogenesis protein NEP1

Background

EMG1 plays a role in the processing of the pre-18S rRNA and small ribosomal subunit assembly (Liu and Thiele, 2001 [PubMed 11694595]) and may play a role in methylation during ribosome biogenesis (Eschrich et al., 2002 [PubMed 11935223]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EMG1