Elongin A Antibody

Images

 
Western Blot: Elongin A Antibody [NBP1-87040] - Analysis in human cell line U-2197.
Immunocytochemistry/ Immunofluorescence: Elongin A Antibody [NBP1-87040] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Elongin A Antibody [NBP1-87040] - Staining of human liver shows moderate to strong nuclear positivity in hepatocytes.
Immunohistochemistry-Paraffin: Elongin A Antibody [NBP1-87040] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Elongin A Antibody [NBP1-87040] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Elongin A Antibody [NBP1-87040] - Staining of human rectum shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Elongin A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDKSKQGLDSFDTGKGAGD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCEB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Elongin A Protein (NBP1-87040PEP)
Publications
Read Publication using
NBP1-87040 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Elongin A Antibody

  • EloA
  • Elongin 110 kDa subunit
  • elongin-A
  • FLJ38760
  • FLJ42849
  • RNA polymerase II transcription factor SIII subunit A1
  • SIII p110
  • SIII
  • TCEB3A
  • transcription elongation factor B (SIII), polypeptide 3 (110kD, elongin A)
  • transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A)
  • transcription elongation factor B alpha subunit
  • transcription elongation factor B polypeptide 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87581
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-45210
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
NBP1-87040
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF8216
Species: Hu, Mu, Rt
Applications: WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBL1-16214
Species: Hu
Applications: WB
NBP1-81531
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-79449
Species: Hu
Applications: WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Publications for Elongin A Antibody (NBP1-87040)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Elongin A Antibody (NBP1-87040) (0)

There are no reviews for Elongin A Antibody (NBP1-87040). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Elongin A Antibody (NBP1-87040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Elongin A Products

Bioinformatics Tool for Elongin A Antibody (NBP1-87040)

Discover related pathways, diseases and genes to Elongin A Antibody (NBP1-87040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Elongin A Antibody (NBP1-87040)

Discover more about diseases related to Elongin A Antibody (NBP1-87040).
 

Pathways for Elongin A Antibody (NBP1-87040)

View related products by pathway.

Research Areas for Elongin A Antibody (NBP1-87040)

Find related products by research area.

Blogs on Elongin A

There are no specific blogs for Elongin A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Elongin A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEB3