Elongin A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Elongin A Antibody [NBP1-87040] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Elongin A Antibody [NBP1-87040] - Staining of human liver shows moderate to strong nuclear positivity in hepatocytes.

Immunohistochemistry-Paraffin: Elongin A Antibody [NBP1-87040] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Elongin A Antibody [NBP1-87040] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Elongin A Antibody [NBP1-87040] - Staining of human rectum shows moderate nuclear positivity in glandular cells.

Analysis in human cell line U-2197.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Elongin A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Elongin A Antibody - BSA Free (NBP1-87040) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Elongin A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDKSKQGLDSFDTGKGAGD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCEB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Elongin A Protein (NBP1-87040PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Elongin A Antibody - BSA Free

• EloA
• Elongin 110 kDa subunit
• elongin-A
• FLJ38760
• FLJ42849
• RNA polymerase II transcription factor SIII subunit A1
• SIII p110
• SIII
• TCEB3A
• transcription elongation factor B (SIII), polypeptide 3 (110kD, elongin A)
• transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A)
• transcription elongation factor B alpha subunit
• transcription elongation factor B polypeptide 3

Background

TCEB3 (Elongin A) is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Elongin A Antibody (NBP1-87040)(1)

Publication using NBP1-87040

• Liu W, Xie L, He YH Et al. Large-scale and high-resolution mass spectrometry-based proteomics profiling defines molecular subtypes of esophageal cancer for therapeutic targeting Nature communications 2021-08-16 [PMID: 34400640] (WB, IF/IHC, Human)

Bioinformatics

• Gene Symbol: TCEB3