HOXA4 Antibody


Western Blot: HOXA4 Antibody [NBP2-32515] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: HOXA4 Antibody [NBP2-32515] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear bodies.
Immunohistochemistry-Paraffin: HOXA4 Antibody [NBP2-32515] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HOXA4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: NTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOXA4 Protein (NBP2-32515PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HOXA4 Antibody

  • homeo box A4
  • homeobox A4
  • Homeobox protein Hox-1.4
  • Homeobox protein Hox-1D
  • homeobox protein Hox-A4
  • HOX1
  • Hox-1.4-like protein
  • HOX1DDfd-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu
Applications: PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HOXA4 Antibody (NBP2-32515) (0)

There are no publications for HOXA4 Antibody (NBP2-32515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA4 Antibody (NBP2-32515) (0)

There are no reviews for HOXA4 Antibody (NBP2-32515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXA4 Antibody (NBP2-32515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HOXA4 Products

Array NBP2-32515

Bioinformatics Tool for HOXA4 Antibody (NBP2-32515)

Discover related pathways, diseases and genes to HOXA4 Antibody (NBP2-32515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA4 Antibody (NBP2-32515)

Discover more about diseases related to HOXA4 Antibody (NBP2-32515).

Pathways for HOXA4 Antibody (NBP2-32515)

View related products by pathway.

PTMs for HOXA4 Antibody (NBP2-32515)

Learn more about PTMs related to HOXA4 Antibody (NBP2-32515).

Blogs on HOXA4

There are no specific blogs for HOXA4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HOXA4 Antibody and receive a gift card or discount.


Gene Symbol HOXA4