HOXA4 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: NTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HOXA4 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for HOXA4 Antibody
Background
HOXA4 is 320 amino acids long, weighing approximately 46 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system, specifically the embryonic nervous system. Current studies are being done on several diseases and disorders including abdominal aortic aneuryms, megacolon, myeloid leukemia, Hirschsprung's disease, hypospadias, teratocarcinoma, ovarian cancer, neuroblastoma, and pancreatitis. HOXA4 has also been shown to have interactions with NFE2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu
Applications: PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Pm
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for HOXA4 Antibody (NBP2-32515) (0)
There are no publications for HOXA4 Antibody (NBP2-32515).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HOXA4 Antibody (NBP2-32515) (0)
There are no reviews for HOXA4 Antibody (NBP2-32515).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HOXA4 Antibody (NBP2-32515) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HOXA4 Products
Bioinformatics Tool for HOXA4 Antibody (NBP2-32515)
Discover related pathways, diseases and genes to HOXA4 Antibody (NBP2-32515). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for HOXA4 Antibody (NBP2-32515)
Discover more about diseases related to HOXA4 Antibody (NBP2-32515).
| | Pathways for HOXA4 Antibody (NBP2-32515)
View related products by pathway.
|
PTMs for HOXA4 Antibody (NBP2-32515)
Learn more about PTMs related to HOXA4 Antibody (NBP2-32515).
|
Blogs on HOXA4