ELOF1 Antibody

Images

 
Western Blot: ELOF1 Antibody [NBP2-87356] - WB Suggested Anti-ELOF1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELOF1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of ELOF1. Peptide sequence: RKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEF The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ELOF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ELOF1 Antibody

  • ELF1
  • elongation factor 1 homolog (ELF1, S. cerevisiae)
  • elongation factor 1 homolog (S. cerevisiae)
  • MGC4549
  • transcription elongation factor 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

8415-A2
Species: Mu
Applications: BA
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-84770
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
202-IL
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
NBP1-87925
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16500
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-45543
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-87356
Species: Hu
Applications: WB

Publications for ELOF1 Antibody (NBP2-87356) (0)

There are no publications for ELOF1 Antibody (NBP2-87356).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELOF1 Antibody (NBP2-87356) (0)

There are no reviews for ELOF1 Antibody (NBP2-87356). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELOF1 Antibody (NBP2-87356) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELOF1 Products

Bioinformatics Tool for ELOF1 Antibody (NBP2-87356)

Discover related pathways, diseases and genes to ELOF1 Antibody (NBP2-87356). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ELOF1

There are no specific blogs for ELOF1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELOF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELOF1