ELMO3 Antibody


Western Blot: ELMO3 Antibody [NBP1-59089] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ELMO3 Antibody Summary

Synthetic peptides corresponding to ELMO3(engulfment and cell motility 3) The peptide sequence was selected from the middle region of ELMO3. Peptide sequence RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSRED.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ELMO3 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ELMO3 Antibody

  • ced-12 homolog 3
  • CED12
  • CED-12
  • ELMO-3
  • engulfment and cell motility 3 (ced-12 homolog, C. elegans)
  • engulfment and cell motility 3
  • engulfment and cell motility protein 3
  • FLJ13824


ELMO3 is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.The protein encoded by this gene is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB
Species: Ce
Applications: ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IP, PEP-ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, ICC
Species: Hu
Applications: WB
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for ELMO3 Antibody (NBP1-59089) (0)

There are no publications for ELMO3 Antibody (NBP1-59089).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELMO3 Antibody (NBP1-59089) (0)

There are no reviews for ELMO3 Antibody (NBP1-59089). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELMO3 Antibody (NBP1-59089) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ELMO3 Antibody Products

Related Products by Gene

Bioinformatics Tool for ELMO3 Antibody (NBP1-59089)

Discover related pathways, diseases and genes to ELMO3 Antibody (NBP1-59089). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELMO3 Antibody (NBP1-59089)

Discover more about diseases related to ELMO3 Antibody (NBP1-59089).

Pathways for ELMO3 Antibody (NBP1-59089)

View related products by pathway.

Research Areas for ELMO3 Antibody (NBP1-59089)

Find related products by research area.

Blogs on ELMO3

There are no specific blogs for ELMO3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ELMO3 Antibody and receive a gift card or discount.


Gene Symbol ELMO3

Customers Who Bought This Also Bought