ELMO3 Antibody

Images

 
Western Blot: ELMO3 Antibody [NBP1-59089] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

ELMO3 Antibody Summary

Immunogen
Synthetic peptides corresponding to ELMO3(engulfment and cell motility 3) The peptide sequence was selected from the middle region of ELMO3. Peptide sequence RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSRED.
Clonality
Polyclonal
Host
Rabbit
Gene
ELMO3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ELMO3 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ELMO3 Antibody

  • ced-12 homolog 3
  • CED12
  • CED-12
  • ELMO-3
  • engulfment and cell motility 3 (ced-12 homolog, C. elegans)
  • engulfment and cell motility 3
  • engulfment and cell motility protein 3
  • FLJ13824

Background

ELMO3 is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.The protein encoded by this gene is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7070
Species: Hu, Rt
Applications: WB
42080002
Species: Ce
Applications: ELISA
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, ICFlow
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-84553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33645
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, ICC
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24469
Species: Hu, Mu, Bv, Ca, Eq, Op, Pm
Applications: WB
NB100-879
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45641
Species: Hu
Applications: WB, IHC
NBP1-47745
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-81646
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ELMO3 Antibody (NBP1-59089) (0)

There are no publications for ELMO3 Antibody (NBP1-59089).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELMO3 Antibody (NBP1-59089) (0)

There are no reviews for ELMO3 Antibody (NBP1-59089). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELMO3 Antibody (NBP1-59089) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELMO3 Antibody Products

Related Products by Gene

Bioinformatics Tool for ELMO3 Antibody (NBP1-59089)

Discover related pathways, diseases and genes to ELMO3 Antibody (NBP1-59089). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELMO3 Antibody (NBP1-59089)

Discover more about diseases related to ELMO3 Antibody (NBP1-59089).
 

Pathways for ELMO3 Antibody (NBP1-59089)

View related products by pathway.

Research Areas for ELMO3 Antibody (NBP1-59089)

Find related products by research area.

Blogs on ELMO3

There are no specific blogs for ELMO3, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ELMO3
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59089 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought