ELMO2 Antibody


Western Blot: ELMO2 Antibody [NBP1-84554] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: ELMO2 Antibody [NBP1-84554] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: ELMO2 Antibody [NBP1-84554] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ELMO2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ELMO2 Protein (NBP1-84554PEP)
Read Publication using
NBP1-84554 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24357722).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ELMO2 Antibody

  • ced-12 homolog 2
  • CED12A
  • ELMO-2
  • engulfment and cell motility 2 (ced-12 homolog, C. elegans)
  • engulfment and cell motility 2
  • engulfment and cell motility protein 2
  • FLJ11656
  • hCed-12A
  • KIAA1834CED12CED-12
  • PH domain protein CED12A
  • Protein ced-12 homolog A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB
Species: Ce
Applications: ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IP, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, PEP-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ELMO2 Antibody (NBP1-84554)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ELMO2 Antibody (NBP1-84554) (0)

There are no reviews for ELMO2 Antibody (NBP1-84554). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ELMO2 Antibody (NBP1-84554) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ELMO2 Products

Bioinformatics Tool for ELMO2 Antibody (NBP1-84554)

Discover related pathways, diseases and genes to ELMO2 Antibody (NBP1-84554). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELMO2 Antibody (NBP1-84554)

Discover more about diseases related to ELMO2 Antibody (NBP1-84554).

Pathways for ELMO2 Antibody (NBP1-84554)

View related products by pathway.

PTMs for ELMO2 Antibody (NBP1-84554)

Learn more about PTMs related to ELMO2 Antibody (NBP1-84554).

Research Areas for ELMO2 Antibody (NBP1-84554)

Find related products by research area.

Blogs on ELMO2

There are no specific blogs for ELMO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ELMO2 Antibody and receive a gift card or discount.


Gene Symbol ELMO2