ELMO2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ELMO2 Antibody [NBP1-84554] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ELMO2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ELMO2 Antibody - BSA Free (NBP1-84554) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ELMO2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD
• Predicted Species: Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELMO2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB, ICC/IF reported in scientific literature (PMID: 24357722). Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ELMO2 Protein (NBP1-84554PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24357722).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ELMO2 Antibody - BSA Free

• ced-12 homolog 2
• CED12A
• ELMO-2
• engulfment and cell motility 2 (ced-12 homolog, C. elegans)
• engulfment and cell motility 2
• engulfment and cell motility protein 2
• FLJ11656
• hCed-12A
• KIAA1834CED12CED-12
• PH domain protein CED12A
• Protein ced-12 homolog A

Background

ELMO2 is encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes. Similarity to a C. elegans protein suggests that this protein may function in apoptosis and in cell migration. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ELMO2 Antibody (NBP1-84554)(1)

Publication using NBP1-84554

• Dayal JH, Cole CL, Pourreyron C et al. Type VII collagen regulates expression of OATP1B3, promotes front-to-rear polarity and increases structural organisation in 3D spheroid cultures of RDEB tumour keratinocytes. J Cell Sci 2014-02-15 [PMID: 24357722] (ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: ELMO2