Recombinant Human ELF5 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ELF5 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 166-263 of Human ELF5

Source: Wheat Germ

Amino Acid Sequence: SRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQED

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ELF5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ELF5 Protein

  • E74-like factor 5 (ets domain transcription factor)
  • E74-like factor 5
  • Epithelium-restricted ESE-1-related Ets factor
  • Epithelium-specific Ets transcription factor 2
  • ESE2ESE-2
  • ETS-related transcription factor Elf-5

Background

The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87945
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14942
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24583
Species: Hu, Mu, Rt, Bv, Eq, Op, Pm
Applications: WB, IHC-P
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-56499
Species: Hu
Applications: ICC/IF
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
MAB6166
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ELF5 Partial Recombinant Protein (H00002001-Q01) (0)

There are no publications for ELF5 Partial Recombinant Protein (H00002001-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELF5 Partial Recombinant Protein (H00002001-Q01) (0)

There are no reviews for ELF5 Partial Recombinant Protein (H00002001-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELF5 Partial Recombinant Protein (H00002001-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ELF5 Partial Recombinant Protein (H00002001-Q01)

Discover related pathways, diseases and genes to ELF5 Partial Recombinant Protein (H00002001-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELF5 Partial Recombinant Protein (H00002001-Q01)

Discover more about diseases related to ELF5 Partial Recombinant Protein (H00002001-Q01).
 

Pathways for ELF5 Partial Recombinant Protein (H00002001-Q01)

View related products by pathway.

PTMs for ELF5 Partial Recombinant Protein (H00002001-Q01)

Learn more about PTMs related to ELF5 Partial Recombinant Protein (H00002001-Q01).
 

Research Areas for ELF5 Partial Recombinant Protein (H00002001-Q01)

Find related products by research area.

Blogs on ELF5

There are no specific blogs for ELF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ELF5 Antibody
NBP2-57358

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ELF5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ELF5