ELF5 Antibody

Images

 
Western Blot: ELF5 Antibody [NBP2-87351] - Host: Rabbit. Target Name: ELF5. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELF5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELF5. Peptide sequence: SEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ELF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ELF5 Antibody

  • E74-like factor 5 (ets domain transcription factor)
  • E74-like factor 5
  • Epithelium-restricted ESE-1-related Ets factor
  • Epithelium-specific Ets transcription factor 2
  • ESE2ESE-2
  • ETS-related transcription factor Elf-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30873
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
NBP2-38896
Species: Hu
Applications: IHC, IHC-P
NBP2-24583
Species: Hu, Mu, Rt, Bv, Eq, Ma-Op, Pm
Applications: WB, IHC, IHC-P
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: WB, ChIP, ICC
AF1759
Species: Hu, Mu
Applications: WB, Simple Western, IP, ChIP, ICC
NBP3-04686
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6166
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
MAB1417
Species: Hu, Mu, Bv
Applications: CyTOF-ready, ICC, ICFlow
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
MAB7619
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Mu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IHC-Fr, IHC-P, IP, IHC-FrFl, KO
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ELF5 Antibody (NBP2-87351) (0)

There are no publications for ELF5 Antibody (NBP2-87351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELF5 Antibody (NBP2-87351) (0)

There are no reviews for ELF5 Antibody (NBP2-87351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELF5 Antibody (NBP2-87351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ELF5 Products

Bioinformatics Tool for ELF5 Antibody (NBP2-87351)

Discover related pathways, diseases and genes to ELF5 Antibody (NBP2-87351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELF5 Antibody (NBP2-87351)

Discover more about diseases related to ELF5 Antibody (NBP2-87351).
 

Pathways for ELF5 Antibody (NBP2-87351)

View related products by pathway.

PTMs for ELF5 Antibody (NBP2-87351)

Learn more about PTMs related to ELF5 Antibody (NBP2-87351).
 

Research Areas for ELF5 Antibody (NBP2-87351)

Find related products by research area.

Blogs on ELF5

There are no specific blogs for ELF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELF5