ELF5 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELF5. Peptide sequence: SEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ELF5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ELF5 Antibody - BSA Free
Background
The protein encoded by the ELF5 gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family.In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears toregulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary glandand prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Twoalternatively spliced transcript variants encoding different isoforms have been described for this gene. (provided byRefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: Neut, WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Publications for ELF5 Antibody (NBP2-87351) (0)
There are no publications for ELF5 Antibody (NBP2-87351).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ELF5 Antibody (NBP2-87351) (0)
There are no reviews for ELF5 Antibody (NBP2-87351).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ELF5 Antibody (NBP2-87351) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ELF5 Products
Research Areas for ELF5 Antibody (NBP2-87351)
Find related products by research area.
|
Blogs on ELF5