ELAVL4 Antibody - BSA Free

Immunohistochemistry: ELAVL4 Antibody [NBP3-35160] - Immunohistochemistry analysis of paraffin-embedded Rat brain using ELAVL4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: ELAVL4 Antibody [NBP3-35160] - Immunofluorescence analysis of paraffin-embedded Rat brain using ELAVL4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: ELAVL4 Antibody [NBP3-35160] - Western blot analysis of various lysates using ELAVL4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunohistochemistry: ELAVL4 Antibody [NBP3-35160] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using ELAVL4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ELAVL4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ELAVL4 Antibody - BSA Free (NBP3-35160) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ELAVL4 (NP_068771.2).
  
  Sequence:
  MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELAVL4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for ELAVL4 Antibody - BSA Free

• abnormal vision, Drosophila, homolog of, like-4
• ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
• HuD
• Paraneoplastic encephalomyelitis antigen HuD

Background

ELAVL4 may play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR. Binds to AU-rich sequences (AREs) of target mRNAs, includingVEGF and FOS mRNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELAVL4